HSD5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14471

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HSD5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: MCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HSD5 Antibody - BSA Free

Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471]

Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471]

Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471]

Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471]

Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471] - Staining of human hippocampus shows distinct positivity in astrocytes.
Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471]

Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471]

Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471]

Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471]

Immunohistochemistry-Paraffin: HSD5 Antibody [NBP2-14471] - Staining in human testis and liver tissues using anti-CEP19 antibody. Corresponding CEP19 RNA-seq data are presented for the same tissues.

Applications for HSD5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HSD5

One of the many clones sequenced and characterized coded a 167 amino acids long protein names Chromosome 3 Open reading frame 34 or HSD5. HSD5 is a soluble protein with at least one functional motif based on sequence homology. There exists a phosphoenol pyruvate carboxylase (Ppc) domain starting near the N-terminal domain. The presence of Ppc domain in HSD5 suggest that this gene may be involved in energy production and conversion pathways. Recent data from gene array analyses and differential expression studies suggest that this gene is expressed in various splice variant form and is up-regulated in various cancer cells including prostate and breast cancer cell lines.

Alternate Names

chromosome 3 open reading frame 34, hypothetical protein LOC84984, MGC14126

Gene Symbol

CEP19

Additional HSD5 Products

Product Documents for HSD5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HSD5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSD5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSD5 Antibody - BSA Free and earn rewards!

Have you used HSD5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies