Human Osteocalcin Alexa Fluor® 488-conjugated Antibody

  
  • Species Reactivity
    Human
  • Specificity
    Detects human Osteocalcin in direct ELISAs.
  • Source
    Monoclonal Mouse IgG1 Clone # 190125
  • Purification
    Protein A or G purified from hybridoma culture supernatant
  • Immunogen
    Human Osteocalcin synthetic peptide
    YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
    Accession # P02818
  • Formulation
    Supplied in a saline solution containing BSA and Sodium Azide.
  • Label
    Alexa Fluor 488
Applications
  •  
    Recommended
    Concentration
    Sample
  • Intracellular Staining by Flow Cytometry
    5 µL/106 cells
    See below
Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.
Data Examples
Intracellular Staining by Flow Cytometry
Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin Alexa Fluor® 488‑conjugated Monoclonal Antibody (Catalog # IC1419G, filled histogram) or isotype control antibody (Catalog # IC002G, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
Intracellular Staining by Flow Cytometry
Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry. Human osteoblasts were stained with Mouse Anti-Human Osteocalcin Alexa Fluor® 488‑conjugated Monoclonal Antibody (Catalog # IC1419G, filled histogram) or isotype control antibody (Catalog # IC002G, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.
Preparation and Storage
  • Shipping
    The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
  • Stability & Storage
    Protect from light. Do not freeze.
    • 12 months from date of receipt, 2 to 8 °C as supplied.
Background: Osteocalcin
Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
  • References:
    1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.
  • Long Name:
    Bone gamma-Carboxyglutamate [gla] Protein
  • Entrez Gene IDs:
    632 (Human); 12096 (Mouse); 25295 (Rat)
  • Alternate Names:
    BGLAP; BGP; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; Osteocalcin
Related Research Areas
Isotype Controls
Description Application Cat# Citations Images  

Mouse IgG1 Alexa Fluor® 488-conjugated Antibody

Ctrl IC002G 3  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....
Staining Reagents
Description Application Cat# Citations Images  

Flow Cytometry Permeabilization/Wash Buffer I (1X)

Flow FC005 5
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Flow Cytometry Fixation Buffer (1X)

Flow FC004 3
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Flow Cytometry Fixation & Permeabilization Buffer Kit I

Flow FC009 3
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Flow Cytometry Fixation/Permeabilization Buffer I (1X)

Flow FC007 2
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Have you used Human Osteocalcin Alexa Fluor® 488-conjugated Antibody?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Order Details

Contact Information

Calculators

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷
R&D Systems Guarantee

Monoclonal
Antibody
Panels For
Screening

Learn More
Monoclonal Antibodies

Feedback

Customer Information