Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Intracellular Staining by Flow Cytometry

Cited:

Flow Cytometry

Label

Allophycocyanin (Excitation = 620-650 nm, Emission = 660-670 nm)

Antibody Source

Monoclonal Mouse IgG1 Clone # 190125
View all Osteocalcin Primary Antibodies »

Product Specifications

Immunogen

Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818

Specificity

Detects human Osteocalcin in direct ELISAs.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Scientific Data Images for Human Osteocalcin APC‑conjugated Antibody

Detection of Osteocalcin antibody in Saos‑2 Human Cell Line antibody by Flow Cytometry.

Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry.

Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human Osteocalcin APC-conjugated Monoclonal Antibody (Catalog # IC1419A, filled histogram) or isotype control antibody (Catalog # IC002A, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.

Detection of Osteocalcin antibody in Human Osteoblasts antibody by Flow Cytometry.

Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry.

Human osteoblasts were stained with Mouse Anti-Human Osteocalcin APC-conjugated Monoclonal Antibody (Catalog # IC1419A, filled histogram) or isotype control antibody (Catalog # IC002A, open histogram). To facilitate intracellular staining, cells were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005). View our protocol for Staining Intracellular Molecules.

Applications for Human Osteocalcin APC‑conjugated Antibody

Application
Recommended Usage

Intracellular Staining by Flow Cytometry

10 µL/106 cells
Sample: Saos‑2 human osteosarcoma cell line and human osteoblasts were fixed with Flow Cytometry Fixation Buffer (Catalog # FC004) and permeabilized with Flow Cytometry Permeabilization/Wash Buffer I (Catalog # FC005)

Spectra Viewer

Plan Your Experiments

Use our spectra viewer to interactively plan your experiments, assessing multiplexing options. View the excitation and emission spectra for our fluorescent dye range and other commonly used dyes.

Spectra Viewer
Spectra Viewer

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now
Flow Cytometry

Formulation, Preparation, and Storage

Purification

Protein A or G purified from hybridoma culture supernatant

Formulation

Supplied in a saline solution containing BSA and Sodium Azide.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Protect from light. Do not freeze.
  • 12 months from date of receipt, 2 to 8 °C as supplied.

Background: Osteocalcin

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

References

  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Long Name

Bone gamma-Carboxyglutamate [gla] Protein

Alternate Names

BGLAP, BGP, OCN

Entrez Gene IDs

632 (Human); 12096 (Mouse); 25295 (Rat)

Gene Symbol

BGLAP

UniProt

P02818

Additional Osteocalcin Products

Product Documents for Human Osteocalcin APC‑conjugated Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Note: Certificate of Analysis not available for kit components.

Download SDS

Product Specific Notices for Human Osteocalcin APC‑conjugated Antibody

For research use only

Citations for Human Osteocalcin APC‑conjugated Antibody

Customer Reviews for Human Osteocalcin APC‑conjugated Antibody

There are currently no reviews for this product. Be the first to review Human Osteocalcin APC‑conjugated Antibody and earn rewards!

Have you used Human Osteocalcin APC‑conjugated Antibody?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies