Human/Rat Osteocalcin Antibody

Catalog # Availability Size / Price Qty
MAB1419
MAB1419-SP
Osteocalcin in MG‑63 Human Cell Line.
20 Images
Product Details
Citations (54)
FAQs
Supplemental Products
Reviews (1)

Human/Rat Osteocalcin Antibody Summary

Species Reactivity
Human, Rat
Specificity
Detects human Osteocalcin in direct ELISAs.
Source
Monoclonal Mouse IgG1 Clone # 190125
Purification
Protein A or G purified from hybridoma culture supernatant
Immunogen
Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Formulation
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 µm filtered solution in PBS.

Applications

Recommended Concentration
Sample
Immunohistochemistry
8-25 µg/mL
See below
CyTOF-ready
Ready to be labeled using established conjugation methods. No BSA or other carrier proteins that could interfere with conjugation.
 
Immunocytochemistry
8-25 µg/mL
See below
Intracellular Staining by Flow Cytometry
2.5 µg/106 cells
See below

Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.

Scientific Data

Immunocytochemistry Osteocalcin antibody in MG-63 Human Cell Line by Immunocytochemistry (ICC). View Larger

Osteocalcin in MG‑63 Human Cell Line. Osteocalcin was detected in immersion fixed MG-63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunocytochemistry Osteocalcin antibody in Human Osteocytes by Immunocytochemistry (ICC). View Larger

Osteocalcin in Human Osteocytes. Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunocytochemistry Osteocalcin antibody in Rat Osteocytes by Immunocytochemistry (ICC). View Larger

Osteocalcin in Rat Osteocytes. Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunohistochemistry Osteocalcin antibody in Human Cartilage by Immunohistochemistry (IHC-P). View Larger

Osteocalcin in Human Cartilage. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human cartilage using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of chondrocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Immunohistochemistry Osteocalcin antibody in Human Osteosarcoma by Immunohistochemistry (IHC-P). View Larger

Osteocalcin in Human Osteosarcoma. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Intracellular Staining by Flow Cytometry Detection of Osteocalcin antibody in Saos-2 Human Cell Line antibody by Flow Cytometry. View Larger

Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Intracellular Staining by Flow Cytometry Detection of Osteocalcin antibody in Human Osteoblasts antibody by Flow Cytometry. View Larger

Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry. Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Western Blot Detection of Human Osteocalcin by Western Blot View Larger

Detection of Human Osteocalcin by Western Blot Exposure of TAZ activator TM-25659 promotes osteogenic differentiation of ADSCs in vitro. a Cell viability was determined after ADSCs were cultured with diverse concentrations of TM-25659 (0–50 μM) at 24 h and 48 h, respectively. B Enhanced osteogenic differentiation of ADSCs was detected and quantified by alkaline phosphatase (ALP) activity assay following ADSC culture with osteoinductive medium and TM-25659 at day 7. c, d Increased mineralization in ADSCs cultured in osteoinductive medium and TM-25659 was observed and quantified via Alizarin Red staining at days 7 and 14. Scale bar = 50 μm. e Significantly increased expression of the osteogenic markers runt-related transcription factor 2 (Runx2), osteopontin (OPN), and osteocalcin (OCN) was observed in ADSCs cultured in osteoinductive medium and TM-25659 at days 7 and 14, respectively. Representative images of Western blots from three independent experiments are shown. Data shown here are mean ± SD from three independent experiments; **P < 0.01, by Student’s t test. GAPDH glyeraldehyde-3-phosphate dehydrogenase, OD optical density Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29514703), licensed under a CC-BY license. Not internally tested by R&D Systems.

Immunocytochemistry/ Immunofluorescence Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence View Larger

Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), 14 days (F, H) and 28 days (A-C, I). Then, the expression levels of RUNX2 (A, D, G), osteocalcin (B, E, H), and DMP-1 (C, F, I) were evaluated immunohistochemically. Representative results of three experiments are shown. (J) Healthy donor-derived MSCs were cultured in MSCGM onto plastic plates (two-dimensional) or nano-fiber plugs (three-dimensional) for 28 days. After RNA extraction, MEPE expression in the 4 groups of healthy donor-derived MSCswas evaluated by real-time PCR. *p<0.05 vs. two-dimensional culture by paired t-test. Scale bars, 50 μm. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0153231), licensed under a CC-BY license. Not internally tested by R&D Systems.

Immunocytochemistry/ Immunofluorescence Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence View Larger

Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), 14 days (F, H) and 28 days (A-C, I). Then, the expression levels of RUNX2 (A, D, G), osteocalcin (B, E, H), and DMP-1 (C, F, I) were evaluated immunohistochemically. Representative results of three experiments are shown. (J) Healthy donor-derived MSCs were cultured in MSCGM onto plastic plates (two-dimensional) or nano-fiber plugs (three-dimensional) for 28 days. After RNA extraction, MEPE expression in the 4 groups of healthy donor-derived MSCswas evaluated by real-time PCR. *p<0.05 vs. two-dimensional culture by paired t-test. Scale bars, 50 μm. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0153231), licensed under a CC-BY license. Not internally tested by R&D Systems.

Immunocytochemistry/ Immunofluorescence Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence View Larger

Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), 14 days (F, H) and 28 days (A-C, I). Then, the expression levels of RUNX2 (A, D, G), osteocalcin (B, E, H), and DMP-1 (C, F, I) were evaluated immunohistochemically. Representative results of three experiments are shown. (J) Healthy donor-derived MSCs were cultured in MSCGM onto plastic plates (two-dimensional) or nano-fiber plugs (three-dimensional) for 28 days. After RNA extraction, MEPE expression in the 4 groups of healthy donor-derived MSCswas evaluated by real-time PCR. *p<0.05 vs. two-dimensional culture by paired t-test. Scale bars, 50 μm. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0153231), licensed under a CC-BY license. Not internally tested by R&D Systems.

Western Blot Detection of Human Osteocalcin by Western Blot View Larger

Detection of Human Osteocalcin by Western Blot Enforced TAZ overexpression enhances osteogenic differentiation of ADSCs in vitro. a Transcriptional coactivator with PDZ-binding motif (TAZ) overexpression (OP) in ADSCs infected with lentiviral particles containing human TAZ cDNA sequence was verified by Western blot. Representative images of Western blots from three independent experiments are shown. b Accelerated cell proliferation was detected in TAZ-overexpressing ADSCs compared with control cells infected with empty lentiviral particles via MTT assay. c Enhanced osteogenic differentiation of ADSCs was detected and quantified by alkaline phosphatase (ALP) activity assay following TAZ overexpression in ADSCs induced in vitro at day 7. d Increased mineralization in TAZ-overexpressing ADSCs cultured in osteoinductive medium was observed via Alizarin Red staining at days 7 and 14. Scale bar = 50 μm. e Significantly enhanced expression of TAZ as well as the osteogenic markers osteopontin (OPN) and osteocalcin (OCN) in TAZ-overexpressing ADSCs cultured in osteoinductive medium at days 7, 14, and 21 was detected by Western blot. Representative images of Western blots from three independent experiments are shown. Data shown here are mean ± SD from three independent experiments; #P ˃ 0.05, *P < 0.05, **P < 0.01, by Student’s t test. GAPDH glyeraldehyde-3-phosphate dehydrogenase, OD optical density, Runx2 runt-related transcription factor 2 Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29514703), licensed under a CC-BY license. Not internally tested by R&D Systems.

Western Blot Detection of Human Osteocalcin by Western Blot View Larger

Detection of Human Osteocalcin by Western Blot TAZ knockdown impairs osteogenic differentiation of ADSCs in vitro. a Transcriptional coactivator with PDZ-binding motif (TAZ) knockdown (KD) in ADSCs infected with shRNA lentiviral particles targeting human TAZ was verified by Western blot. Representative images of Western blots from three independent experiments are shown. b TAZ and its downstream targets CTGF and Cyr61 were downregulated in TAZ-knockdown ADSCs as determined by quantitative RT-PCR. c Cell proliferation was compromised in TAZ-knockdown ADSCs compared with control cells infected with nontargeting lentiviral vectors with scrambled sequence. d Compromised osteogenic differentiation of ADSCs was detected and quantified by alkaline phosphatase (ALP) activity assay following TAZ knockdown of ADSCs induced in vitro at day 7. e Reduced mineralization in TAZ-knockdown ADSCs cultured in osteoinductive medium was observed via Alizarin Red staining at days 7, 14, and 21. f Significantly reduced expression of TAZ as well as the osteogenic markers osteopontin (OPN) and osteocalcin (OCN) in TAZ-knockdown ADSCs cultured in osteoinductive medium at days 7, 14, and 21 was detected by Western blot. Representative images of Western blots from three independent experiments are shown. Data shown here are mean ± SD from three independent experiments, #P ˃ 0.05, *P < 0.05, **P < 0.01, by Student’s t test. GAPDH glyeraldehyde-3-phosphate dehydrogenase, NC normal control, OD optical density, Runx2 runt-related transcription factor 2 Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29514703), licensed under a CC-BY license. Not internally tested by R&D Systems.

Western Blot Detection of Human Osteocalcin by Western Blot View Larger

Detection of Human Osteocalcin by Western Blot TAZ is upregulated during osteogenesis while it is downregulated during adipogenesis in human ADSCs. a Osteogenic differentiation of ADSCs was induced in vitro and monitored by Alizarin Red and von Kossa staining at the indicated time points (days 7, 14, 21, and 28 after induction). Scale bar = 50 μm. b,c Transcriptional coactivator with PDZ-binding motif (TAZ) protein was significantly increased during the osteogenic differentiation process of ADSCs, concomitant with markedly upregulated expression of the osteogenic markers runt-related transcription factor 2 (Runx2), osteopontin (OPN), and osteocalcin (OCN). Representative images of Western blots from three independent experiments are shown. d The mRNA levels of TAZ and the osteogenic markers were significantly increased during ADSC osteogenic differentiation in vitro as measured by quantitative RT-PCR. e Adipogenic differentiation of ADSCs was induced in vitro and determined by Oil Red O staining at the indicated time points (days 7, 14, and 21 after induction). Scale bar = 50 μm. f TAZ protein was significantly downregulated during the adipogenic differentiation process of ADSCs. Representative images of Western blots from three independent experiments are shown. g The mRNA levels of TAZ decreased while the adipogenic marker increased during ADSC adipogenic differentiation in vitro as measured by quantitative RT-PCR. Data shown here are mean ± SD from three independent experiments; #P ˃ 0.05, *P < 0.05, **P < 0.01, by ANOVA. ALP alkaline phosphatase, GAPDH glyeraldehyde-3-phosphate dehydrogenase, PPAR gamma peroxisome proliferator-activated receptor-gamma Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29514703), licensed under a CC-BY license. Not internally tested by R&D Systems.

Immunocytochemistry/ Immunofluorescence Detection of Rat Osteocalcin by Immunocytochemistry/Immunofluorescence View Larger

Detection of Rat Osteocalcin by Immunocytochemistry/Immunofluorescence In vitro differentiation capacity of young and old BM-MSCs: (A) Representative micrographs from each experimental group showing morphological change after 21 days of differentiation. (B) Results of adipogenic, osteogenic and chondrogenic differentiation. Representative micrographs showing anti-FABP4, Oil Red O, anti-osteocalcin, Alizarin Red-S and anti-aggrecan staining in cultured BM-MSCs from each experimental group. Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/21992089), licensed under a CC-BY license. Not internally tested by R&D Systems.

Immunohistochemistry Detection of Human Osteocalcin by Immunohistochemistry View Larger

Detection of Human Osteocalcin by Immunohistochemistry TM-25659 promotes in vivo bone formation of ADSCs. a Schematic description of experimental procedure for in vivo transplantation. Adipose-derived stem cells (ASCs) were initially treated with osteoinductive medium and TM-25659 for consecutive 7 days, then harvested, seeded on porous beta -TCP blocks as a carrier, and subcutaneously transplanted into nude mice (six animals per experimental group). Six weeks later all transplants were harvested for further analysis. b Hematoxylin and eosin (H&E) and Masson trichrome staining revealed markedly enhanced bone formation in samples from ADSCs treated with TM-25659 compared with vehicle-treated samples. Scale bar = 100 μm. c Quantification of bone formation in samples indicated significantly more bone formation in ADSCs treated with TM-25659. Ten images of Masson staining (400×) were randomly selected in the slides from two experimental groups and captured under microscopy. The area of new bone in each image was marked using ImageJ and the percentage of new bone over total area was calculated. d Immunohistochemical staining of osteopontin (OPN) and osteocalcin (OCN) in samples revealed elevated OPN and OCN abundance in samples from ADSCs treated with TM-25659 compared with vehicle-treated samples. Scale bar = 100 μm. Data are shown as fold-change compared with vehicle-treated samples which were defined as 1.0. Data shown here are mean ± SD from two independent experiments; **P < 0.01, by Student’s t test. NB new bone, S scaffold Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29514703), licensed under a CC-BY license. Not internally tested by R&D Systems.

Immunocytochemistry/ Immunofluorescence Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence View Larger

Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), 14 days (F, H) and 28 days (A-C, I). Then, the expression levels of RUNX2 (A, D, G), osteocalcin (B, E, H), and DMP-1 (C, F, I) were evaluated immunohistochemically. Representative results of three experiments are shown. (J) Healthy donor-derived MSCs were cultured in MSCGM onto plastic plates (two-dimensional) or nano-fiber plugs (three-dimensional) for 28 days. After RNA extraction, MEPE expression in the 4 groups of healthy donor-derived MSCswas evaluated by real-time PCR. *p<0.05 vs. two-dimensional culture by paired t-test. Scale bars, 50 μm. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0153231), licensed under a CC-BY license. Not internally tested by R&D Systems.

Immunocytochemistry/ Immunofluorescence Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence View Larger

Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), 14 days (F, H) and 28 days (A-C, I). Then, the expression levels of RUNX2 (A, D, G), osteocalcin (B, E, H), and DMP-1 (C, F, I) were evaluated immunohistochemically. Representative results of three experiments are shown. (J) Healthy donor-derived MSCs were cultured in MSCGM onto plastic plates (two-dimensional) or nano-fiber plugs (three-dimensional) for 28 days. After RNA extraction, MEPE expression in the 4 groups of healthy donor-derived MSCswas evaluated by real-time PCR. *p<0.05 vs. two-dimensional culture by paired t-test. Scale bars, 50 μm. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0153231), licensed under a CC-BY license. Not internally tested by R&D Systems.

Immunocytochemistry/ Immunofluorescence Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence View Larger

Detection of Human Osteocalcin by Immunocytochemistry/Immunofluorescence Nano-fiber plugs induce osteogenesis of human MSCs.Healthy donor-derived MSCs were seeded onto plastic plates (A-C) or injected into the nano-fiber plugs (D-I), and then cultured in MSCGM for 1 day (D), 7 days (E, G), 14 days (F, H) and 28 days (A-C, I). Then, the expression levels of RUNX2 (A, D, G), osteocalcin (B, E, H), and DMP-1 (C, F, I) were evaluated immunohistochemically. Representative results of three experiments are shown. (J) Healthy donor-derived MSCs were cultured in MSCGM onto plastic plates (two-dimensional) or nano-fiber plugs (three-dimensional) for 28 days. After RNA extraction, MEPE expression in the 4 groups of healthy donor-derived MSCswas evaluated by real-time PCR. *p<0.05 vs. two-dimensional culture by paired t-test. Scale bars, 50 μm. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0153231), licensed under a CC-BY license. Not internally tested by R&D Systems.

Immunohistochemistry Detection of Human Osteocalcin by Immunohistochemistry View Larger

Detection of Human Osteocalcin by Immunohistochemistry TM-25659 delivery by oral gavage promotes in vivo bone formation of ADSCs. a Schematic description of the experimental procedure for in vivo transplantation. Adipose-derived stem cells (ASCs) were initially treated with osteoinductive medium for 7 consecutive days and then harvested, seeded on porous beta -TCP blocks as carriers, and subcutaneously transplanted into nude mice (six animals per experimental group). Six weeks later all transplants were harvested for further analysis. b Hematoxylin and eosin (H&E) and Masson trichrome staining revealed markedly enhanced bone formation in samples from animals treated with TM-25659 via oral gavage compared with vehicle-treated samples. Scale bar = 100 μm. c Quantification of bone formation in samples indicated significantly more bone formation in samples from animals treated with TM-25659. Ten images of Masson staining (400×) were randomly selected in the slides from two experimental groups and captured under microscopy. The area of new bone in each image was marked using ImageJ and the percentage of new bone over total area was calculated. d Immunohistochemical staining of osteopontin (OPN) and osteocalcin (OCN) in samples revealed elevated OPN and OCN abundance in samples from animals treated with TM-25659 compared with vehicle-treated samples. Scale bar = 100 μm. Data are shown as fold-change compared with vehicle-treated samples which were defined as 1.0. Data shown here are mean ± SD from two independent experiments; *P < 0.05, **P < 0.01, by Student’s t test. NB new bone, S scaffold Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/29514703), licensed under a CC-BY license. Not internally tested by R&D Systems.

Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Preparation and Storage

Reconstitution
Reconstitute at 0.5 mg/mL in sterile PBS.
Loading...
Shipping
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below. *Small pack size (SP) is shipped with polar packs. Upon receipt, store it immediately at -20 to -70 °C
Stability & Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 6 months, -20 to -70 °C under sterile conditions after reconstitution.

Background: Osteocalcin

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

References
  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.
Long Name
Bone gamma-Carboxyglutamate [gla] Protein
Entrez Gene IDs
632 (Human); 12096 (Mouse); 25295 (Rat)
Alternate Names
BGLAP; BGP; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; Osteocalcin

Product Datasheets

You must select a language.

x

Citations for Human/Rat Osteocalcin Antibody

R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.

54 Citations: Showing 1 - 10
Filter your results:

Filter by:

  1. Dominoes with interlocking consequences triggered by zinc: involvement of microelement-stimulated MSC-derived exosomes in senile osteogenesis and osteoclast dialogue
    Authors: Shi Yin, Sihan Lin, Jingyi Xu, Guangzheng Yang, Hongyan Chen, Xinquan Jiang
    J Nanobiotechnology
  2. Trabecular Titanium for Orthopedic Applications: Balancing Antimicrobial with Osteoconductive Properties by Varying Silver Contents
    Authors: Diez-Escudero A, Carlsson E, Andersson B et al.
    ACS Applied Materials & Interfaces
  3. The use of heparin/polycation coacervate sustain release system to compare the bone regenerative potentials of 5 BMPs using a critical sized calvarial bone defect model
    Authors: Xueqin Gao, Mintai P. Hwang, Nathaniel Wright, Aiping Lu, Joseph J. Ruzbarsky, Matthieu Huard et al.
    Biomaterials
  4. Mummy Material Can Promote Differentiation of Adipose Derived Stem Cells into Osteoblast through Enhancement of Bone Specific Transcription Factors Expression
    Authors: Maryam Eyvazi, Raheleh Farahzadi, Nahid Karimian Fathi, Mohammad Karimipour, Jafar Soleimani Rad, Azadeh Montaseri
    Advanced Pharmaceutical Bulletin
  5. Fetal Muse-based therapy prevents lethal radio-induced gastrointestinal syndrome by intestinal regeneration
    Authors: Honorine Dushime, Stéphanie G. Moreno, Christine Linard, Annie Adrait, Yohann Couté, Juliette Peltzer et al.
    Stem Cell Research & Therapy
  6. Local nascent protein deposition and remodelling guide mesenchymal stromal cell mechanosensing and fate in three-dimensional hydrogels
    Authors: Claudia Loebel, Robert L. Mauck, Jason A. Burdick
    Nature Materials
  7. Human Mesenchymal Stem Cell‐Derived Miniature Joint System for Disease Modeling and Drug Testing
    Authors: Zhong Li, Zixuan Lin, Silvia Liu, Haruyo Yagi, Xiurui Zhang, Lauren Yocum et al.
    Advanced Science
  8. BMAL1-TTK-H2Bub1 loop deficiency contributes to impaired BM-MSC-mediated bone formation in senile osteoporosis
    Authors: Li Jinteng, Xu Peitao, Yu Wenhui, Ye Guiwen, Ye Feng, Xu Xiaojun et al.
    Molecular Therapy - Nucleic Acids
  9. Electrospun Scaffolds of Polylactic Acid, Collagen, and Amorphous Calcium Phosphate for Bone Repair
    Authors: Cárdenas-Aguazaco, W;Camacho, B;Gómez-Pachón, EY;Lara-Bertrand, AL;Silva-Cote, I;
    Pharmaceutics
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC
  10. Mechanical and Functional Improvement of ?-TCP Scaffolds for Use in Bone Tissue Engineering
    Authors: Umrath, F;Schmitt, LF;Kliesch, SM;Schille, C;Geis-Gerstorfer, J;Gurewitsch, E;Bahrini, K;Peters, F;Reinert, S;Alexander, D;
    Journal of functional biomaterials
    Species: Human
    Sample Types: Whole Cells
  11. Cholinergic-like neurons and cerebral spheroids bearing the PSEN1 p.Ile416Thr variant mirror Alzheimer's disease neuropathology
    Authors: Gomez-Sequeda, N;Mendivil-Perez, M;Jimenez-Del-Rio, M;Lopera, F;Velez-Pardo, C;
    Scientific reports
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  12. Role of cartilage and bone matrix regulation in early equine osteochondrosis
    Authors: SK Grissom, SA Semevolos, K Duesterdie
    Bone Reports, 2023-01-05;18(0):101653.
    Species: Equine
    Sample Types: Whole Tissue
    Applications: IHC
  13. CTR9 drives osteochondral lineage differentiation of human mesenchymal stem cells via epigenetic regulation of BMP-2 signaling
    Authors: NT Chan, MS Lee, Y Wang, J Galipeau, WJ Li, W Xu
    Science Advances, 2022-11-16;8(46):eadc9222.
    Species: Human
    Sample Types: Transduced Whole Cells
    Applications: ICC
  14. Msx1+ stem cells recruited by bioactive tissue engineering graft for bone regeneration
    Authors: X Zhang, W Jiang, C Xie, X Wu, Q Ren, F Wang, X Shen, Y Hong, H Wu, Y Liao, Y Zhang, R Liang, W Sun, Y Gu, T Zhang, Y Chen, W Wei, S Zhang, W Zou, H Ouyang
    Nature Communications, 2022-09-05;13(1):5211.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC
  15. Circulating Osteogenic Progenitor Cells Enhanced with Teriparatide or Denosumab Treatment
    Authors: M Giner, MA Vázquez-Gá, MJ Miranda, J Bocio-Nuñe, FJ Olmo-Monte, MA Rico, MA Colmenero, MJ Montoya-Ga
    Journal of Clinical Medicine, 2022-08-14;11(16):.
    Species: Human
    Sample Types: Whole Cells
    Applications: Flow Cytometry
  16. Highly elastic and bioactive bone biomimetic scaffolds based on platelet lysate and biomineralized cellulose nanocrystals
    Authors: JP Ribeiro, RMA Domingues, PS Babo, LP Nogueira, JE Reseland, RL Reis, M Gomez-Flor, ME Gomes
    Carbohydrate polymers, 2022-05-20;292(0):119638.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC
  17. Comparison between hydroxyapatite and polycaprolactone in inducing osteogenic differentiation and augmenting maxillary bone regeneration in rats
    Authors: NA Luchman, R Megat Abdu, SH Zainal Ari, NS Nasruddin, SF Lau, F Yazid
    PeerJ, 2022-05-02;10(0):e13356.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC
  18. Enamel Matrix Derivative Enhances the Odontoblastic Differentiation of Dental Pulp Stem Cells via Activating MAPK Signaling Pathways
    Authors: B Zhang, M Xiao, X Cheng, Y Bai, H Chen, Q Yu, L Qiu
    Stem Cells International, 2022-04-28;2022(0):2236250.
    Species: Mouse
    Sample Types: Whole Tissue
    Applications: IHC
  19. BMP-2 Enhances Osteogenic Differentiation of Human Adipose-Derived and Dental Pulp Stem Cells in 2D and 3D In Vitro Models
    Authors: S Martin-Igl, L Milian, M Sancho-Tel, R Salvador-C, JJ Martín de, C Carda, M Mata
    Stem Cells International, 2022-03-04;2022(0):4910399.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  20. Adipocytes disrupt the translational programme of acute lymphoblastic leukaemia to favour tumour survival and persistence
    Authors: Q Heydt, C Xintaropou, A Clear, M Austin, I Pislariu, F Miraki-Mou, P Cutillas, K Korfi, M Calaminici, W Cawthorn, K Suchacki, A Nagano, JG Gribben, M Smith, JD Cavenagh, H Oakervee, A Castleton, D Taussig, B Peck, A Wilczynska, L McNaughton, D Bonnet, F Mardakheh, B Patel
    Nature Communications, 2021-09-17;12(1):5507.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC/IF
  21. Microenvironment Influences on Human Umbilical Cord Mesenchymal Stem Cell-Based Bone Regeneration
    Authors: L E, R Lu, J Sun, H Li, W Xu, H Xing, X Wang, T Cheng, S Zhang, X Ma, R Zhang, H Liu
    Stem Cells International, 2021-08-17;2021(0):4465022.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  22. MicroRNA-27b targets CBFB to inhibit differentiation of human bone marrow mesenchymal stem cells into hypertrophic chondrocytes
    Authors: S Lv, J Xu, L Chen, H Wu, W Feng, Y Zheng, P Li, H Zhang, L Zhang, G Chi, Y Li
    Stem Cell Res Ther, 2020-09-11;11(1):392.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC
  23. Stabilization of heterochromatin by CLOCK promotes stem cell rejuvenation and cartilage regeneration
    Authors: C Liang, Z Liu, M Song, W Li, Z Wu, Z Wang, Q Wang, S Wang, K Yan, L Sun, T Hishida, Y Cai, JCI Belmonte, P Guillen, P Chan, Q Zhou, W Zhang, J Qu, GH Liu
    Cell Res., 2020-07-31;0(0):.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  24. The combinatory effect of sinusoidal electromagnetic field and VEGF promotes osteogenesis and angiogenesis of mesenchymal stem cell-laden PCL/HA implants in a rat subcritical cranial defect
    Authors: J Chen, C Tu, X Tang, H Li, J Yan, Y Ma, H Wu, C Liu
    Stem Cell Res Ther, 2019-12-16;10(1):379.
    Species: Rat
    Sample Types: Whole Cells
    Applications: ICC
  25. Osteoblasts are "educated" by crosstalk with metastatic breast cancer cells in the bone tumor microenvironment
    Authors: AD Kolb, AB Shupp, D Mukhopadhy, FC Marini, KM Bussard
    Breast Cancer Res., 2019-02-27;21(1):31.
    Species: Human
    Sample Types: Whole Cells, Whole Tissue
    Applications: ICC, IHC-P
  26. Comparison of Immunosuppressive and Angiogenic Properties of Human Amnion-Derived Mesenchymal Stem Cells between 2D and 3D Culture Systems
    Authors: V Miceli, M Pampalone, S Vella, AP Carreca, G Amico, PG Conaldi
    Stem Cells Int, 2019-02-18;2019(0):7486279.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  27. Differential expression patterns of Toll Like Receptors and Interleukin-37 between calcific aortic and mitral valve cusps in humans
    Authors: A Kapelouzou, C Kontogiann, DI Tsilimigra, G Georgiopou, L Kaklamanis, L Tsourelis, DV Cokkinos
    Cytokine, 2019-02-01;116(0):150-160.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC
  28. Influences of donor and host age on human muscle-derived stem cell-mediated bone regeneration
    Authors: X Gao, A Lu, Y Tang, J Schneppend, AB Liebowitz, AC Scibetta, ER Morris, H Cheng, C Huard, S Amra, B Wang, MA Hall, WR Lowe, J Huard
    Stem Cell Res Ther, 2018-11-21;9(1):316.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC-Fr
  29. Pharmacological activation of TAZ enhances osteogenic differentiation and bone formation of adipose-derived stem cells
    Authors: Y Zhu, Y Wu, J Cheng, Q Wang, Z Li, Y Wang, D Wang, H Wang, W Zhang, J Ye, H Jiang, L Wang
    Stem Cell Res Ther, 2018-03-07;9(1):53.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC
  30. A biomaterials approach to influence stem cell fate in injectable cell-based therapies
    Authors: MH Amer, FRAJ Rose, KM Shakesheff, LJ White
    Stem Cell Res Ther, 2018-02-21;9(1):39.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  31. Rapid Rapamycin-Only Induced Osteogenic Differentiation of Blood-Derived Stem Cells and Their Adhesion to Natural and Artificial Scaffolds
    Authors: C Arianna, C Eliana, A Flavio, R Marco, D Giacomo, S Manuel, B Elena, G Alessandra
    Stem Cells Int, 2017-07-26;2017(0):2976541.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  32. Identification of multipotent stem cells in human brain tissue following stroke
    Authors: K Tatebayash, Y Tanaka, A Nakano-Doi, R Sakuma, S Kamachi, M Shirakawa, K Uchida, H Kageyama, T Takagi, S Yoshimura, T Matsuyama, T Nakagomi
    Stem Cells Dev, 2017-04-19;0(0):.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  33. Collagen type XV and the 'osteogenic status'
    Authors: G Lisignoli, E Lambertini, C Manferdini, E Gabusi, L Penolazzi, F Paolella, M Angelozzi, V Casagranda, R Piva
    J. Cell. Mol. Med, 2017-03-22;0(0):.
    Species: Human
    Sample Types: Whole Cells
    Applications: Flow Cytometry
  34. 25-Hydroxyvitamin D3 induces osteogenic differentiation of human mesenchymal stem cells
    Authors: YR Lou, TC Toh, YH Tee, H Yu
    Sci Rep, 2017-02-17;7(0):42816.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  35. Transcriptome sequencing wide functional analysis of human mesenchymal stem cells in response to TLR4 ligand
    Sci Rep, 2016-07-22;6(0):30311.
    Species: Human
    Sample Types: Whole Cells
    Applications: IHC
  36. Immobilized WNT Proteins Act as a Stem Cell Niche for Tissue Engineering
    Stem Cell Reports, 2016-07-12;7(1):126-37.
    Species: Human
    Sample Types: Whole Cells
    Applications: IHC
  37. Ultra-Porous Nanoparticle Networks: A Biomimetic Coating Morphology for Enhanced Cellular Response and Infiltration
    Authors: N Nasiri, A Ceramidas, S Mukherjee, A Panneersel, DR Nisbet, A Tricoli
    Sci Rep, 2016-04-14;6(0):24305.
    Species: Mouse
    Sample Types: Whole Cells
    Applications: IHC-Fr
  38. PDL regeneration via cell homing in delayed replantation of avulsed teeth.
    Authors: Zhu W, Zhang Q, Zhang Y, Cen L, Wang J
    J Transl Med, 2015-11-14;13(0):357.
    Species: Canine
    Sample Types: Whole Tissue
    Applications: IHC-P
  39. Primary osteoblast-like cells from patients with end-stage kidney disease reflect gene expression, proliferation, and mineralization characteristics ex vivo.
    Authors: Pereira R, Delany A, Khouzam N, Bowen R, Freymiller E, Salusky I, Wesseling-Perry K
    Kidney Int, 2014-10-29;87(3):593-601.
    Species: Human
    Sample Types: Whole Cells
    Applications: IHC
  40. Gene expression profile analysis of human mesenchymal stem cells from herniated and degenerated intervertebral discs reveals different expression of osteopontin.
    Authors: Marfia G, Navone S, Di Vito C, Tabano S, Giammattei L, Di Cristofori A, Gualtierotti R, Tremolada C, Zavanone M, Caroli M, Torchia F, Miozzo M, Rampini P, Riboni L, Campanella R
    Stem Cells Dev, 2014-10-29;24(3):320-8.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  41. Identification of a cell-of-origin for fibroblasts comprising the fibrotic reticulum in idiopathic pulmonary fibrosis.
    Authors: Xia H, Bodempudi V, Benyumov A, Hergert P, Tank D, Herrera J, Braziunas J, Larsson O, Parker M, Rossi D, Smith K, Peterson M, Limper A, Jessurun J, Connett J, Ingbar D, Phan S, Bitterman P, Henke C
    Am J Pathol, 2014-03-13;184(5):1369-83.
    Species: Human
    Sample Types: Whole Cells
    Applications: IHC
  42. Bone matrix, cellularity, and structural changes in a rat model with high-turnover osteoporosis induced by combined ovariectomy and a multiple-deficient diet.
    Authors: Govindarajan P, Bocker W, El Khassawna T, Kampschulte M, Schlewitz G, Huerter B, Sommer U, Durselen L, Ignatius A, Bauer N, Szalay G, Wenisch S, Lips K, Schnettler R, Langheinrich A, Heiss C
    Am J Pathol, 2013-12-31;184(3):765-77.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC
  43. Derivation and expansion using only small molecules of human neural progenitors for neurodegenerative disease modeling.
    Authors: Reinhardt P, Glatza M, Hemmer K, Tsytsyura Y, Thiel C, Hoing S, Moritz S, Parga J, Wagner L, Bruder J, Wu G, Schmid B, Ropke A, Klingauf J, Schwamborn J, Gasser T, Scholer H, Sterneckert J
    PLoS ONE, 2013-03-22;8(3):e59252.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  44. Dilatational band formation in bone.
    Authors: Poundarik, Atharva, Diab, Tamim, Sroga, Grazyna, Ural, Ani, Boskey, Adele L, Gundberg, Caren M, Vashishth, Deepak
    Proc Natl Acad Sci U S A, 2012-11-05;109(47):19178-83.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC
  45. Age-related changes in rat bone-marrow mesenchymal stem cell plasticity.
    Authors: Asumda FZ, Chase PB
    BMC Cell Biol., 2011-10-12;12(0):44.
    Species: Rat
    Sample Types: Whole Cells
    Applications: ICC
  46. The guidance of human mesenchymal stem cell differentiation in vitro by controlled modifications to the cell substrate.
    Authors: Curran JM, Chen R, Hunt JA
    Biomaterials, 2006-06-02;27(27):4783-93.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  47. A hybrid coating of biomimetic apatite and osteocalcin.
    Authors: Krout A, Wen HB, Hippensteel E, Li P
    J Biomed Mater Res A, 2005-06-15;73(4):377-87.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC
  48. TRPM8 channel inhibitor-encapsulated hydrogel as a tunable surface for bone tissue engineering
    Authors: Acharya TK, Kumar S, Tiwari N et al.
    Scientific reports
  49. The Effects of Mechanical Stimulation on Controlling and Maintaining Marrow Stromal Cell Differentiation Into Vascular Smooth Muscle Cells
    Authors: Raphael Yao, Joyce Y. Wong
    Journal of Biomechanical Engineering
  50. Peroxisomes in Different Skeletal Cell Types during Intramembranous and Endochondral Ossification and Their Regulation during Osteoblast Differentiation by Distinct Peroxisome Proliferator-Activated Receptors.
    Authors: Qian G, Fan W, Ahlemeyer B, Karnati S, Baumgart-Vogt E
    PLoS ONE, 2015-12-02;10(12):e0143439.
  51. Digital Light Processing 3D Printing of Gyroid Scaffold with Isosorbide-Based Photopolymer for Bone Tissue Engineering
    Authors: Fiona Verisqa, Jae-Ryung Cha, Linh Nguyen, Hae-Won Kim, Jonathan C. Knowles
    Biomolecules
  52. Serum and tissue biomarkers in aortic stenosis
    Authors: Alkistis Kapelouzou, Loukas Tsourelis, Loukas Kaklamanis, Dimitrios Degiannis, Nektarios Kogerakis, Dennis V. Cokkinos
    Global Cardiology Science and Practice
  53. Differentiation of human neuroblastoma cells toward the osteogenic lineage by mTOR inhibitor
    Authors: A Carpentieri, E Cozzoli, M Scimeca, E Bonanno, A M Sardanelli, A Gambacurta
    Cell Death & Disease
  54. Icaritin promotes the osteogenesis of bone marrow mesenchymal stem cells via the regulation of sclerostin expression
    Authors: Qiushi Wei, Bin Wang, Hailan Hu, Chuhai Xie, Long Ling, Jianliang Gao et al.
    International Journal of Molecular Medicine

FAQs

No product specific FAQs exist for this product, however you may

View all Antibody FAQs
Loading...

Reviews for Human/Rat Osteocalcin Antibody

Average Rating: 5 (Based on 1 Review)

5 Star
100%
4 Star
0%
3 Star
0%
2 Star
0%
1 Star
0%

Have you used Human/Rat Osteocalcin Antibody?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Filter by:


Human/Rat Osteocalcin Antibody
By Anonymous on 08/17/2021
Application: IHC Sample Tested: Osteosarcoma Species: Human