Human/Rat Osteocalcin Antibody Summary
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Complete Your Research
Complete Your Experiment
Applications
Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.
Scientific Data

Osteocalcin in MG‑63 Human Cell Line. Osteocalcin was detected in immersion fixed MG-63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Osteocalcin in Human Osteocytes. Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Osteocalcin in Rat Osteocytes. Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Osteocalcin in Human Cartilage. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human cartilage using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of chondrocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Osteocalcin in Human Osteosarcoma. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. Saos-2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry. Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Reconstitution Calculator
Preparation and Storage
- 12 months from date of receipt, -20 to -70 °C as supplied.
- 1 month, 2 to 8 °C under sterile conditions after reconstitution.
- 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Background: Osteocalcin
Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
Product Datasheets
Citations for Human/Rat Osteocalcin Antibody
R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.
33
Citations: Showing 1 - 10
Filter your results:
Filter by:
-
CTR9 drives osteochondral lineage differentiation of human mesenchymal stem cells via epigenetic regulation of BMP-2 signaling
Authors: NT Chan, MS Lee, Y Wang, J Galipeau, WJ Li, W Xu
Science Advances, 2022;8(46):eadc9222.
Species: Human
Sample Types: Transduced Whole Cells
Applications: ICC -
Msx1+ stem cells recruited by bioactive tissue engineering graft for bone regeneration
Authors: X Zhang, W Jiang, C Xie, X Wu, Q Ren, F Wang, X Shen, Y Hong, H Wu, Y Liao, Y Zhang, R Liang, W Sun, Y Gu, T Zhang, Y Chen, W Wei, S Zhang, W Zou, H Ouyang
Nature Communications, 2022;13(1):5211.
-
Highly elastic and bioactive bone biomimetic scaffolds based on platelet lysate and biomineralized cellulose nanocrystals
Authors: JP Ribeiro, RMA Domingues, PS Babo, LP Nogueira, JE Reseland, RL Reis, M Gomez-Flor, ME Gomes
Carbohydrate polymers, 2022;292(0):119638.
Species: Human
Sample Types: Whole Tissue
Applications: IHC -
Comparison between hydroxyapatite and polycaprolactone in inducing osteogenic differentiation and augmenting maxillary bone regeneration in rats
Authors: NA Luchman, R Megat Abdu, SH Zainal Ari, NS Nasruddin, SF Lau, F Yazid
PeerJ, 2022;10(0):e13356.
Species: Rat
Sample Types: Whole Tissue
Applications: IHC -
Enamel Matrix Derivative Enhances the Odontoblastic Differentiation of Dental Pulp Stem Cells via Activating MAPK Signaling Pathways
Authors: B Zhang, M Xiao, X Cheng, Y Bai, H Chen, Q Yu, L Qiu
Stem Cells International, 2022;2022(0):2236250.
Species: Mouse
Sample Types: Whole Tissue
Applications: IHC -
BMP-2 Enhances Osteogenic Differentiation of Human Adipose-Derived and Dental Pulp Stem Cells in 2D and 3D In Vitro Models
Authors: S Martin-Igl, L Milian, M Sancho-Tel, R Salvador-C, JJ Martín de, C Carda, M Mata
Stem Cells International, 2022;2022(0):4910399.
Species: Human
Sample Types: Whole Cells
Applications: ICC -
Microenvironment Influences on Human Umbilical Cord Mesenchymal Stem Cell-Based Bone Regeneration
Authors: L E, R Lu, J Sun, H Li, W Xu, H Xing, X Wang, T Cheng, S Zhang, X Ma, R Zhang, H Liu
Stem Cells International, 2021;2021(0):4465022.
Species: Human
Sample Types: Whole Cells
Applications: ICC -
Adipocytes disrupt the translational programme of acute lymphoblastic leukaemia to favour tumour survival and persistence
Authors: Q Heydt, C Xintaropou, A Clear, M Austin, I Pislariu, F Miraki-Mou, P Cutillas, K Korfi, M Calaminici, W Cawthorn, K Suchacki, A Nagano, JG Gribben, M Smith, JD Cavenagh, H Oakervee, A Castleton, D Taussig, B Peck, A Wilczynska, L McNaughton, D Bonnet, F Mardakheh, B Patel
Nature Communications, 2021;12(1):5507.
Species: Human
Sample Types: Whole Cells
Applications: ICC/IF -
Stabilization of heterochromatin by CLOCK promotes stem cell rejuvenation and cartilage regeneration
Authors: C Liang, Z Liu, M Song, W Li, Z Wu, Z Wang, Q Wang, S Wang, K Yan, L Sun, T Hishida, Y Cai, JCI Belmonte, P Guillen, P Chan, Q Zhou, W Zhang, J Qu, GH Liu
Cell Res., 2020;0(0):.
Species: Human
Sample Types: Whole Cells
Applications: ICC -
MicroRNA-27b targets CBFB to inhibit differentiation of human bone marrow mesenchymal stem cells into hypertrophic chondrocytes
Authors: S Lv, J Xu, L Chen, H Wu, W Feng, Y Zheng, P Li, H Zhang, L Zhang, G Chi, Y Li
Stem Cell Res Ther, 2020;11(1):392.
Species: Rat
Sample Types: Whole Tissue
Applications: IHC -
Comparison of Immunosuppressive and Angiogenic Properties of Human Amnion-Derived Mesenchymal Stem Cells between 2D and 3D Culture Systems
Authors: V Miceli, M Pampalone, S Vella, AP Carreca, G Amico, PG Conaldi
Stem Cells Int, 2019;2019(0):7486279.
Species: Human
Sample Types: Whole Cells
Applications: ICC -
Differential expression patterns of Toll Like Receptors and Interleukin-37 between calcific aortic and mitral valve cusps in humans
Authors: A Kapelouzou, C Kontogiann, DI Tsilimigra, G Georgiopou, L Kaklamanis, L Tsourelis, DV Cokkinos
Cytokine, 2019;116(0):150-160.
Species: Human
Sample Types: Whole Tissue
Applications: IHC -
Osteoblasts are "educated" by crosstalk with metastatic breast cancer cells in the bone tumor microenvironment
Authors: AD Kolb, AB Shupp, D Mukhopadhy, FC Marini, KM Bussard
Breast Cancer Res., 2019;21(1):31.
Species: Human
Sample Types: Whole Cells
Applications: ICC -
The combinatory effect of sinusoidal electromagnetic field and VEGF promotes osteogenesis and angiogenesis of mesenchymal stem cell-laden PCL/HA implants in a rat subcritical cranial defect
Authors: J Chen, C Tu, X Tang, H Li, J Yan, Y Ma, H Wu, C Liu
Stem Cell Res Ther, 2019;10(1):379.
Species: Rat
Sample Types: Whole Cells
Applications: ICC -
Pharmacological activation of TAZ enhances osteogenic differentiation and bone formation of adipose-derived stem cells
Authors: Y Zhu, Y Wu, J Cheng, Q Wang, Z Li, Y Wang, D Wang, H Wang, W Zhang, J Ye, H Jiang, L Wang
Stem Cell Res Ther, 2018;9(1):53.
Species: Human
Sample Types: Whole Tissue
Applications: IHC -
Influences of donor and host age on human muscle-derived stem cell-mediated bone regeneration
Authors: X Gao, A Lu, Y Tang, J Schneppend, AB Liebowitz, AC Scibetta, ER Morris, H Cheng, C Huard, S Amra, B Wang, MA Hall, WR Lowe, J Huard
Stem Cell Res Ther, 2018;9(1):316.
Species: Human
Sample Types: Whole Tissue
Applications: IHC-Fr -
A biomaterials approach to influence stem cell fate in injectable cell-based therapies
Authors: MH Amer, FRAJ Rose, KM Shakesheff, LJ White
Stem Cell Res Ther, 2018;9(1):39.
Species: Human
Sample Types: Whole Cells
Applications: ICC -
Collagen type XV and the 'osteogenic status'
Authors: G Lisignoli, E Lambertini, C Manferdini, E Gabusi, L Penolazzi, F Paolella, M Angelozzi, V Casagranda, R Piva
J. Cell. Mol. Med, 2017;0(0):.
Species: Human
Sample Types: Whole Cells
Applications: Flow Cytometry -
25-Hydroxyvitamin D3 induces osteogenic differentiation of human mesenchymal stem cells
Authors: YR Lou, TC Toh, YH Tee, H Yu
Sci Rep, 2017;7(0):42816.
Species: Human
Sample Types: Whole Cells
Applications: ICC -
Identification of multipotent stem cells in human brain tissue following stroke
Authors: K Tatebayash, Y Tanaka, A Nakano-Doi, R Sakuma, S Kamachi, M Shirakawa, K Uchida, H Kageyama, T Takagi, S Yoshimura, T Matsuyama, T Nakagomi
Stem Cells Dev, 2017;0(0):.
Species: Human
Sample Types: Whole Cells
Applications: ICC -
Rapid Rapamycin-Only Induced Osteogenic Differentiation of Blood-Derived Stem Cells and Their Adhesion to Natural and Artificial Scaffolds
Authors: C Arianna, C Eliana, A Flavio, R Marco, D Giacomo, S Manuel, B Elena, G Alessandra
Stem Cells Int, 2017;2017(0):2976541.
Species: Human
Sample Types: Whole Cells
Applications: ICC -
Ultra-Porous Nanoparticle Networks: A Biomimetic Coating Morphology for Enhanced Cellular Response and Infiltration
Authors: N Nasiri, A Ceramidas, S Mukherjee, A Panneersel, DR Nisbet, A Tricoli
Sci Rep, 2016;6(0):24305.
Species: Mouse
Sample Types: Whole Cells
Applications: IHC-Fr -
Immobilized WNT Proteins Act as a Stem Cell Niche for Tissue Engineering
Stem Cell Reports, 2016;7(1):126-37.
Species: Human
Sample Types: Whole Cells
Applications: IHC -
Transcriptome sequencing wide functional analysis of human mesenchymal stem cells in response to TLR4 ligand
Sci Rep, 2016;6(0):30311.
Species: Human
Sample Types: Whole Cells
Applications: IHC -
PDL regeneration via cell homing in delayed replantation of avulsed teeth.
Authors: Zhu W, Zhang Q, Zhang Y, Cen L, Wang J
J Transl Med, 2015;13(0):357.
Species: Canine
Sample Types: Whole Tissue
Applications: IHC-P -
Primary osteoblast-like cells from patients with end-stage kidney disease reflect gene expression, proliferation, and mineralization characteristics ex vivo.
Authors: Pereira R, Delany A, Khouzam N, Bowen R, Freymiller E, Salusky I, Wesseling-Perry K
Kidney Int, 2015;87(3):593-601.
Species: Human
Sample Types: Whole Cells
Applications: IHC -
Identification of a cell-of-origin for fibroblasts comprising the fibrotic reticulum in idiopathic pulmonary fibrosis.
Authors: Xia H, Bodempudi V, Benyumov A, Hergert P, Tank D, Herrera J, Braziunas J, Larsson O, Parker M, Rossi D, Smith K, Peterson M, Limper A, Jessurun J, Connett J, Ingbar D, Phan S, Bitterman P, Henke C
Am J Pathol, 2014;184(5):1369-83.
Species: Human
Sample Types: Whole Cells
Applications: IHC -
Bone matrix, cellularity, and structural changes in a rat model with high-turnover osteoporosis induced by combined ovariectomy and a multiple-deficient diet.
Authors: Govindarajan P, Bocker W, El Khassawna T, Kampschulte M, Schlewitz G, Huerter B, Sommer U, Durselen L, Ignatius A, Bauer N, Szalay G, Wenisch S, Lips K, Schnettler R, Langheinrich A, Heiss C
Am J Pathol, 2014;184(3):765-77.
Species: Rat
Sample Types: Whole Tissue
Applications: IHC -
Derivation and expansion using only small molecules of human neural progenitors for neurodegenerative disease modeling.
Authors: Reinhardt P, Glatza M, Hemmer K, Tsytsyura Y, Thiel C, Hoing S, Moritz S, Parga J, Wagner L, Bruder J, Wu G, Schmid B, Ropke A, Klingauf J, Schwamborn J, Gasser T, Scholer H, Sterneckert J
PLoS ONE, 2013;8(3):e59252.
Species: Human
Sample Types: Whole Cells
Applications: ICC -
Dilatational band formation in bone.
Authors: Poundarik, Atharva, Diab, Tamim, Sroga, Grazyna, Ural, Ani, Boskey, Adele L, Gundberg, Caren M, Vashishth, Deepak
Proc Natl Acad Sci U S A, 2012;109(47):19178-83.
Species: Human
Sample Types: Whole Tissue
Applications: IHC -
Age-related changes in rat bone-marrow mesenchymal stem cell plasticity.
Authors: Asumda FZ, Chase PB
BMC Cell Biol., 2011;12(0):44.
Species: Rat
Sample Types: Whole Cells
Applications: ICC -
The guidance of human mesenchymal stem cell differentiation in vitro by controlled modifications to the cell substrate.
Authors: Curran JM, Chen R, Hunt JA
Biomaterials, 2006;27(27):4783-93.
Species: Human
Sample Types: Whole Cells
Applications: ICC -
A hybrid coating of biomimetic apatite and osteocalcin.
Authors: Krout A, Wen HB, Hippensteel E, Li P
J Biomed Mater Res A, 2005;73(4):377-87.
Species: Rat
Sample Types: Whole Tissue
Applications: IHC
FAQs
No product specific FAQs exist for this product, however you may
View all Antibody FAQsIsotype Controls
Reconstitution Buffers
Secondary Antibodies
Reviews for Human/Rat Osteocalcin Antibody
There are currently no reviews for this product. Be the first to review Human/Rat Osteocalcin Antibody and earn rewards!
Have you used Human/Rat Osteocalcin Antibody?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image