Human/Rat Osteocalcin Antibody

(15 citations)   
  • Species Reactivity
    Human, Rat
  • Specificity
    Detects human Osteocalcin in direct ELISAs.
  • Source
    Monoclonal Mouse IgG1 Clone # 190125
  • Purification
    Protein A or G purified from hybridoma culture supernatant
  • Immunogen
    Human Osteocalcin synthetic peptide
    YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
    Accession # P02818
  • Formulation
    Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 µm filtered solution in PBS.
  • Label
    Unconjugated
Applications
  •  
    Recommended
    Concentration
    Sample
  • Immunohistochemistry
    8-25 µg/mL
    See below
  • CyTOF-ready
    Ready to be labeled using established conjugation methods. No BSA or other carrier proteins that could interfere with conjugation.
  • Immunocytochemistry
    8-25 µg/mL
    See below
  • Intracellular Staining by Flow Cytometry
    2.5 µg/106 cells
    See below
Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.
Data Examples
Immunocytochemistry

Osteocalcin in MG‑63 Human Cell Line. Osteocalcin was detected in immersion fixed MG‑63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunocytochemistry

Osteocalcin in Human Osteocytes. Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunocytochemistry

Osteocalcin in Rat Osteocytes. Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunohistochemistry

Osteocalcin in Human Cartilage. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human cartilage using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of chondrocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Immunohistochemistry

Osteocalcin in Human Osteosarcoma. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Intracellular Staining by Flow Cytometry

Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Intracellular Staining by Flow Cytometry

Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry. Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Preparation and Storage
  • Reconstitution
    Reconstitute at 0.5 mg/mL in sterile PBS.
  • Shipping
    The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below. *Small pack size (SP) is shipped with polar packs. Upon receipt, store it immediately at -20 to -70 °C
  • Stability & Storage
    Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
    • 12 months from date of receipt, -20 to -70 °C as supplied.
    • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
    • 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Background: Osteocalcin
Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.
  • References:
    1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.
  • Long Name:
    Bone gamma-Carboxyglutamate [gla] Protein
  • Entrez Gene IDs:
    632 (Human); 12096 (Mouse); 25295 (Rat)
  • Alternate Names:
    BGLAP; BGP; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; Osteocalcin
Related Research Areas
Citations:

R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.

15 Citations: Showing 1 - 10
Filter your results:

Species
Applications
Sample Type
  1. Collagen type XV and the 'osteogenic status'
    Authors: G Lisignoli, E Lambertini, C Manferdini, E Gabusi, L Penolazzi, F Paolella, M Angelozzi, V Casagranda, R Piva
    J. Cell. Mol. Med, 2017;0(0):.
    Species: Human
    Sample Type: Whole Cells
    Application: Flow
  2. 25-Hydroxyvitamin D3 induces osteogenic differentiation of human mesenchymal stem cells
    Authors: YR Lou, TC Toh, YH Tee, H Yu
    Sci Rep, 2017;7(0):42816.
    Species: Human
    Sample Type: Whole Cells
    Application: ICC
  3. Rapid Rapamycin-Only Induced Osteogenic Differentiation of Blood-Derived Stem Cells and Their Adhesion to Natural and Artificial Scaffolds
    Authors: C Arianna, C Eliana, A Flavio, R Marco, D Giacomo, S Manuel, B Elena, G Alessandra
    Stem Cells Int, 2017;2017(0):2976541.
    Species: Human
    Sample Type: Whole Cells
    Application: ICC
  4. Immobilized WNT Proteins Act as a Stem Cell Niche for Tissue Engineering
    Stem Cell Reports, 2016;7(1):126-37.
    Species: Human
    Sample Type: Whole Cells
    Application: IHC - PFA fixed
  5. Transcriptome sequencing wide functional analysis of human mesenchymal stem cells in response to TLR4 ligand
    Sci Rep, 2016;6(0):30311.
    Species: Human
    Sample Type: Whole Cells
    Application: IHC - PFA fixed
  6. Ultra-Porous Nanoparticle Networks: A Biomimetic Coating Morphology for Enhanced Cellular Response and Infiltration
    Authors: N Nasiri, A Ceramidas, S Mukherjee, A Panneersel, DR Nisbet, A Tricoli
    Sci Rep, 2016;6(0):24305.
    Species: Mouse
    Sample Type: Whole Cells
    Application: IHC Fresh
  7. PDL regeneration via cell homing in delayed replantation of avulsed teeth.
    Authors: Zhu W, Zhang Q, Zhang Y, Cen L, Wang J
    J Transl Med, 2015;13(0):357.
    Species: Canine
    Sample Type: Whole Tissue
    Application: IHC - Paraffin embedded
  8. Primary osteoblast-like cells from patients with end-stage kidney disease reflect gene expression, proliferation, and mineralization characteristics ex vivo.
    Authors: Pereira R, Delany A, Khouzam N, Bowen R, Freymiller E, Salusky I, Wesseling-Perry K
    Kidney Int, 2015;87(3):593-601.
    Species: Human
    Sample Type: Whole Cells
    Application: IHC Not Specified
  9. Bone matrix, cellularity, and structural changes in a rat model with high-turnover osteoporosis induced by combined ovariectomy and a multiple-deficient diet.
    Authors: Govindarajan P, Bocker W, El Khassawna T, Kampschulte M, Schlewitz G, Huerter B, Sommer U, Durselen L, Ignatius A, Bauer N, Szalay G, Wenisch S, Lips K, Schnettler R, Langheinrich A, Heiss C
    Am J Pathol, 2014;184(3):765-77.
    Species: Rat
    Sample Type: Whole Tissue
    Application: IHC
  10. Identification of a cell-of-origin for fibroblasts comprising the fibrotic reticulum in idiopathic pulmonary fibrosis.
    Authors: Xia H, Bodempudi V, Benyumov A, Hergert P, Tank D, Herrera J, Braziunas J, Larsson O, Parker M, Rossi D, Smith K, Peterson M, Limper A, Jessurun J, Connett J, Ingbar D, Phan S, Bitterman P, Henke C
    Am J Pathol, 2014;184(5):1369-83.
    Species: Human
    Sample Type: Whole Cells
    Application: IF
  11. Derivation and expansion using only small molecules of human neural progenitors for neurodegenerative disease modeling.
    Authors: Reinhardt P, Glatza M, Hemmer K, Tsytsyura Y, Thiel C, Hoing S, Moritz S, Parga J, Wagner L, Bruder J, Wu G, Schmid B, Ropke A, Klingauf J, Schwamborn J, Gasser T, Scholer H, Sterneckert J
    PLoS ONE, 2013;8(3):e59252.
    Species: Human
    Sample Type: Whole Cells
    Application: ICC
  12. Dilatational band formation in bone.
    Authors: Poundarik, Atharva, Diab, Tamim, Sroga, Grazyna, Ural, Ani, Boskey, Adele L, Gundberg, Caren M, Vashishth, Deepak
    Proc Natl Acad Sci U S A, 2012;109(47):19178-83.
    Species: Human
    Sample Type: Whole Tissue
    Application: IHC - Not specified
  13. Age-related changes in rat bone-marrow mesenchymal stem cell plasticity.
    Authors: Asumda FZ, Chase PB
    BMC Cell Biol., 2011;12(0):44.
    Species: Rat
    Sample Type: Whole Cells
    Application: ICC
  14. The guidance of human mesenchymal stem cell differentiation in vitro by controlled modifications to the cell substrate.
    Authors: Curran JM, Chen R, Hunt JA
    Biomaterials, 2006;27(27):4783-93.
    Species: Human
    Sample Type: Whole Cells
    Application: ICC
  15. A hybrid coating of biomimetic apatite and osteocalcin.
    Authors: Krout A, Wen HB, Hippensteel E, Li P
    J Biomed Mater Res A, 2005;73(4):377-87.
    Species: Rat
    Sample Type: Whole Tissue
    Application: IHC
Expand to show all 15 Citations
Cell and Tissue Staining Kits
Description Application Cat# Citations Images  

Anti-Mouse HRP-DAB Cell & Tissue Staining Kit

CTS002 14
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....
Immunohistochemistry Reagents
Description Application Cat# Citations Images  

Antigen Retrieval Reagent-Universal

CTS015 10
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Antigen Retrieval Reagent-Basic

CTS013 4
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mounting Medium

CTS011 4
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Antigen Retrieval Reagent Sampler (50 mL each)

CTS016
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Antigen Retrieval Reagent-Acidic

CTS014
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

NorthernLights Guard Mounting Media

NL996
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

VisUCyte Antigen Retrieval Reagent-Universal

VCTS023
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

VisUCyte Antigen Retrieval Reagent-Basic

VCTS021
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

VisUCyte Antigen Retrieval Reagent-Acidic

VCTS022
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....
Isotype Controls
Description Application Cat# Citations Images  

Mouse IgG1 Isotype Control

Ctrl MAB002 138  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse IgG1 Isotype Control

Ctrl MAB002R 1
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....
Secondary Antibodies
Description Application Cat# Citations Images  

Mouse IgG HRP-conjugated Antibody

WB HAF007 26  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse F(ab)2 IgG (H+L) PE-conjugated Antibody

Flow F0102B 10  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Donkey Anti-Mouse IgG NorthernLights™ NL557-conjugate Antibody

Flow, IHC, ICC NL007 9
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Donkey Anti-Mouse IgG Biotinylated Antibody

WB BAF018 1
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse IgG HRP-conjugated Antibody

WB HAF018 9  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse F(ab)2 IgG (H+L) APC-conjugated Antibody

Flow F0101B 2  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Donkey Anti-Mouse IgG NorthernLights™ NL637-conjugated Antibody

Flow, IHC, ICC NL008 8
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Donkey Anti-Mouse IgG NorthernLights™ NL493-conjugated Antibody

Flow, IHC, ICC NL009 5
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse IgG Antibody

WB AF007 4
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse F(ab)2 IgG (H+L) Fluorescein-conjugated Antibody

Flow F0103B 5  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Goat Anti-Mouse IgG Biotinylated Antibody

WB BAF007 4
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse/Rabbit IgG VisUCyte HRP Polymer Antibody

IHC VC002  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse IgG VisUCyte HRP Polymer Antibody

IHC VC001  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Mouse F(ab)2 IgG (H+L) PerCP-conjugated Antibody

Flow F0114  
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Goat Anti-Mouse IgG Fc Affinity Purified Polyclonal Ab

G-202-C 2
View Sizes & Prices
Catalog# Size Price Stock Quantity
Loading Information....

Have you used Human/Rat Osteocalcin Antibody?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Order Details

Contact Information

Calculators

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷
R&D Systems Guarantee

Monoclonal
Antibody
Panels For
Screening

Learn More
Monoclonal Antibodies

Feedback

Customer Information