Human/Rat Osteocalcin Antibody

MAB1419 18 Citations Datasheet / COA / SDS

Catalog #	Availability	Size / Price	Qty
MAB1419
MAB1419-SP

Bulk Orders

7 Images

Product Details

Citations (18)

Supplemental Products

Reviews

Summary Data Examples Preparation and Storage Reconstitution Calculator Background Product Datasheets Related Research Areas

Human/Rat Osteocalcin Antibody Summary

Species Reactivity

Human, Rat

Specificity

Detects human Osteocalcin in direct ELISAs.

Source

Monoclonal Mouse IgG₁ Clone # 190125

Purification

Protein A or G purified from hybridoma culture supernatant

Immunogen

Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818

Formulation

Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 µm filtered solution in PBS.

Label

Unconjugated

Applications

Recommended Concentration

Sample

Immunohistochemistry

8-25 µg/mL

See below

CyTOF-ready

Ready to be labeled using established conjugation methods. No BSA or other carrier proteins that could interfere with conjugation.

Immunocytochemistry

8-25 µg/mL

See below

Intracellular Staining by Flow Cytometry

2.5 µg/10⁶ cells

See below

Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.

Data Examples

Immunocytochemistry

View Larger

Osteocalcin in MG‑63 Human Cell Line. Osteocalcin was detected in immersion fixed MG‑63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunocytochemistry

View Larger

Osteocalcin in Human Osteocytes. Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunocytochemistry

View Larger

Osteocalcin in Rat Osteocytes. Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunohistochemistry

View Larger

Osteocalcin in Human Cartilage. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human cartilage using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of chondrocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Immunohistochemistry

View Larger

Osteocalcin in Human Osteosarcoma. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Intracellular Staining by Flow Cytometry

View Larger

Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Intracellular Staining by Flow Cytometry

View Larger

Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry. Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Reconstitution Calculator

Preparation and Storage

Reconstitution

Reconstitute at 0.5 mg/mL in sterile PBS.

Reconstitution Buffer Available

Reconstitution Buffer 1 (PBS)

Shipping

The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below. *Small pack size (SP) is shipped with polar packs. Upon receipt, store it immediately at -20 to -70 °C

Stability & Storage

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

12 months from date of receipt, -20 to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
6 months, -20 to -70 °C under sterile conditions after reconstitution.

Background: Osteocalcin

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

References

Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.

Long Name

Bone gamma-Carboxyglutamate [gla] Protein

Entrez Gene IDs

632 (Human); 12096 (Mouse); 25295 (Rat)

Alternate Names

BGLAP; BGP; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; Osteocalcin

Product Datasheets

Product Datasheet

COA

SDS

Related Research Areas

Citations for Human/Rat Osteocalcin Antibody

R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.

18 Citations: Showing 1 - 10
Filter your results:

Filter by:

A biomaterials approach to influence stem cell fate in injectable cell-based therapies
Authors: MH Amer, FRAJ Rose, KM Shakesheff, LJ White
Stem Cell Res Ther, 2018;9(1):39.
Species: Human
Sample Types: Whole Cells
Applications: ICC
Pharmacological activation of TAZ enhances osteogenic differentiation and bone formation of adipose-derived stem cells
Authors: Y Zhu, Y Wu, J Cheng, Q Wang, Z Li, Y Wang, D Wang, H Wang, W Zhang, J Ye, H Jiang, L Wang
Stem Cell Res Ther, 2018;9(1):53.
Species: Human
Sample Types: Whole Tissue
Applications: IHC
Collagen type XV and the 'osteogenic status'
Authors: G Lisignoli, E Lambertini, C Manferdini, E Gabusi, L Penolazzi, F Paolella, M Angelozzi, V Casagranda, R Piva
J. Cell. Mol. Med, 2017;0(0):.
Species: Human
Sample Types: Whole Cells
Applications: Flow
Rapid Rapamycin-Only Induced Osteogenic Differentiation of Blood-Derived Stem Cells and Their Adhesion to Natural and Artificial Scaffolds
Authors: C Arianna, C Eliana, A Flavio, R Marco, D Giacomo, S Manuel, B Elena, G Alessandra
Stem Cells Int, 2017;2017(0):2976541.
Species: Human
Sample Types: Whole Cells
Applications: ICC
25-Hydroxyvitamin D3 induces osteogenic differentiation of human mesenchymal stem cells
Authors: YR Lou, TC Toh, YH Tee, H Yu
Sci Rep, 2017;7(0):42816.
Species: Human
Sample Types: Whole Cells
Applications: ICC
Identification of multipotent stem cells in human brain tissue following stroke
Authors: K Tatebayash, Y Tanaka, A Nakano-Doi, R Sakuma, S Kamachi, M Shirakawa, K Uchida, H Kageyama, T Takagi, S Yoshimura, T Matsuyama, T Nakagomi
Stem Cells Dev, 2017;0(0):.
Species: Human
Sample Types: Whole Cells
Applications: ICC
Immobilized WNT Proteins Act as a Stem Cell Niche for Tissue Engineering
Stem Cell Reports, 2016;7(1):126-37.
Species: Human
Sample Types: Whole Cells
Applications: IHC - PFA fixed
Transcriptome sequencing wide functional analysis of human mesenchymal stem cells in response to TLR4 ligand
Sci Rep, 2016;6(0):30311.
Species: Human
Sample Types: Whole Cells
Applications: IHC - PFA fixed
Ultra-Porous Nanoparticle Networks: A Biomimetic Coating Morphology for Enhanced Cellular Response and Infiltration
Authors: N Nasiri, A Ceramidas, S Mukherjee, A Panneersel, DR Nisbet, A Tricoli
Sci Rep, 2016;6(0):24305.
Species: Mouse
Sample Types: Whole Cells
Applications: IHC Fresh
Primary osteoblast-like cells from patients with end-stage kidney disease reflect gene expression, proliferation, and mineralization characteristics ex vivo.
Authors: Pereira R, Delany A, Khouzam N, Bowen R, Freymiller E, Salusky I, Wesseling-Perry K
Kidney Int, 2015;87(3):593-601.
Species: Human
Sample Types: Whole Cells
Applications: IHC Not Specified

PDL regeneration via cell homing in delayed replantation of avulsed teeth.
Authors: Zhu W, Zhang Q, Zhang Y, Cen L, Wang J
J Transl Med, 2015;13(0):357.
Species: Canine
Sample Types: Whole Tissue
Applications: IHC - Paraffin embedded

Identification of a cell-of-origin for fibroblasts comprising the fibrotic reticulum in idiopathic pulmonary fibrosis.
Authors: Xia H, Bodempudi V, Benyumov A, Hergert P, Tank D, Herrera J, Braziunas J, Larsson O, Parker M, Rossi D, Smith K, Peterson M, Limper A, Jessurun J, Connett J, Ingbar D, Phan S, Bitterman P, Henke C
Am J Pathol, 2014;184(5):1369-83.
Species: Human
Sample Types: Whole Cells
Applications: IF

Bone matrix, cellularity, and structural changes in a rat model with high-turnover osteoporosis induced by combined ovariectomy and a multiple-deficient diet.
Authors: Govindarajan P, Bocker W, El Khassawna T, Kampschulte M, Schlewitz G, Huerter B, Sommer U, Durselen L, Ignatius A, Bauer N, Szalay G, Wenisch S, Lips K, Schnettler R, Langheinrich A, Heiss C
Am J Pathol, 2014;184(3):765-77.
Species: Rat
Sample Types: Whole Tissue
Applications: IHC

Derivation and expansion using only small molecules of human neural progenitors for neurodegenerative disease modeling.
Authors: Reinhardt P, Glatza M, Hemmer K, Tsytsyura Y, Thiel C, Hoing S, Moritz S, Parga J, Wagner L, Bruder J, Wu G, Schmid B, Ropke A, Klingauf J, Schwamborn J, Gasser T, Scholer H, Sterneckert J
PLoS ONE, 2013;8(3):e59252.
Species: Human
Sample Types: Whole Cells
Applications: ICC

Dilatational band formation in bone.
Authors: Poundarik, Atharva, Diab, Tamim, Sroga, Grazyna, Ural, Ani, Boskey, Adele L, Gundberg, Caren M, Vashishth, Deepak
Proc Natl Acad Sci U S A, 2012;109(47):19178-83.
Species: Human
Sample Types: Whole Tissue
Applications: IHC - Not specified

Age-related changes in rat bone-marrow mesenchymal stem cell plasticity.
Authors: Asumda FZ, Chase PB
BMC Cell Biol., 2011;12(0):44.
Species: Rat
Sample Types: Whole Cells
Applications: ICC

The guidance of human mesenchymal stem cell differentiation in vitro by controlled modifications to the cell substrate.
Authors: Curran JM, Chen R, Hunt JA
Biomaterials, 2006;27(27):4783-93.
Species: Human
Sample Types: Whole Cells
Applications: ICC

A hybrid coating of biomimetic apatite and osteocalcin.
Authors: Krout A, Wen HB, Hippensteel E, Li P
J Biomed Mater Res A, 2005;73(4):377-87.
Species: Rat
Sample Types: Whole Tissue
Applications: IHC