Human/Rat Osteocalcin Antibody

Catalog # Availability Size / Price Qty
MAB1419
MAB1419-SP
Osteocalcin in MG‑63 Human Cell Line.
7 Images
Product Details
Citations (18)
FAQs
Supplemental Products
Reviews

Human/Rat Osteocalcin Antibody Summary

Species Reactivity
Human, Rat
Specificity
Detects human Osteocalcin in direct ELISAs.
Source
Monoclonal Mouse IgG1 Clone # 190125
Purification
Protein A or G purified from hybridoma culture supernatant
Immunogen
Human Osteocalcin synthetic peptide
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Accession # P02818
Formulation
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 µm filtered solution in PBS.
Label
Unconjugated

Applications

Recommended Concentration
Sample
Immunohistochemistry
8-25 µg/mL
See below
CyTOF-ready
Ready to be labeled using established conjugation methods. No BSA or other carrier proteins that could interfere with conjugation.
 
Immunocytochemistry
8-25 µg/mL
See below
Intracellular Staining by Flow Cytometry
2.5 µg/106 cells
See below

Please Note: Optimal dilutions should be determined by each laboratory for each application. General Protocols are available in the Technical Information section on our website.

Data Examples

Immunocytochemistry Osteocalcin in MG‑63 Human Cell Line. View Larger

Osteocalcin in MG‑63 Human Cell Line. Osteocalcin was detected in immersion fixed MG‑63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunocytochemistry Osteocalcin in Human Osteocytes. View Larger

Osteocalcin in Human Osteocytes. Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunocytochemistry Osteocalcin in Rat Osteocytes. View Larger

Osteocalcin in Rat Osteocytes. Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Immunohistochemistry Osteocalcin in Human Cartilage. View Larger

Osteocalcin in Human Cartilage. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human cartilage using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of chondrocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Immunohistochemistry Osteocalcin in Human Osteosarcoma. View Larger

Osteocalcin in Human Osteosarcoma. Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Intracellular Staining by Flow Cytometry Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. View Larger

Detection of Osteocalcin in Saos‑2 Human Cell Line by Flow Cytometry. Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Intracellular Staining by Flow Cytometry Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry. View Larger

Detection of Osteocalcin in Human Osteoblasts by Flow Cytometry. Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.

Reconstitution Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Preparation and Storage

Reconstitution
Reconstitute at 0.5 mg/mL in sterile PBS.
Reconstitution Buffer Available
Reconstitution Buffer 1 (PBS)
Catalog #
Availability
Size / Price
Qty
RB01
Shipping
The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below. *Small pack size (SP) is shipped with polar packs. Upon receipt, store it immediately at -20 to -70 °C
Stability & Storage
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 6 months, -20 to -70 °C under sterile conditions after reconstitution.

Background: Osteocalcin

Osteocalcin, also known as Bone gamma -Carboxyglutamic Acid Protein, is a secreted protein whose expression is restricted to cells of the osteoblast lineage (1). It has been frequently used as a marker for osteoblast lineage cells.

References
  1. Lian, J.B. et al. (1999) Vitamin. Horm. 55:443.
Long Name
Bone gamma-Carboxyglutamate [gla] Protein
Entrez Gene IDs
632 (Human); 12096 (Mouse); 25295 (Rat)
Alternate Names
BGLAP; BGP; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone gamma-carboxyglutamate (gla) protein; Bone Gla protein; Gamma-carboxyglutamic acid-containing protein; OC; OCN; Osteocalcin

Product Datasheets

Citations for Human/Rat Osteocalcin Antibody

R&D Systems personnel manually curate a database that contains references using R&D Systems products. The data collected includes not only links to publications in PubMed, but also provides information about sample types, species, and experimental conditions.

18 Citations: Showing 1 - 10
Filter your results:

Filter by:

  1. A biomaterials approach to influence stem cell fate in injectable cell-based therapies
    Authors: MH Amer, FRAJ Rose, KM Shakesheff, LJ White
    Stem Cell Res Ther, 2018;9(1):39.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  2. Pharmacological activation of TAZ enhances osteogenic differentiation and bone formation of adipose-derived stem cells
    Authors: Y Zhu, Y Wu, J Cheng, Q Wang, Z Li, Y Wang, D Wang, H Wang, W Zhang, J Ye, H Jiang, L Wang
    Stem Cell Res Ther, 2018;9(1):53.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC
  3. Collagen type XV and the 'osteogenic status'
    Authors: G Lisignoli, E Lambertini, C Manferdini, E Gabusi, L Penolazzi, F Paolella, M Angelozzi, V Casagranda, R Piva
    J. Cell. Mol. Med, 2017;0(0):.
    Species: Human
    Sample Types: Whole Cells
    Applications: Flow
  4. Rapid Rapamycin-Only Induced Osteogenic Differentiation of Blood-Derived Stem Cells and Their Adhesion to Natural and Artificial Scaffolds
    Authors: C Arianna, C Eliana, A Flavio, R Marco, D Giacomo, S Manuel, B Elena, G Alessandra
    Stem Cells Int, 2017;2017(0):2976541.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  5. 25-Hydroxyvitamin D3 induces osteogenic differentiation of human mesenchymal stem cells
    Authors: YR Lou, TC Toh, YH Tee, H Yu
    Sci Rep, 2017;7(0):42816.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  6. Identification of multipotent stem cells in human brain tissue following stroke
    Authors: K Tatebayash, Y Tanaka, A Nakano-Doi, R Sakuma, S Kamachi, M Shirakawa, K Uchida, H Kageyama, T Takagi, S Yoshimura, T Matsuyama, T Nakagomi
    Stem Cells Dev, 2017;0(0):.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  7. Immobilized WNT Proteins Act as a Stem Cell Niche for Tissue Engineering
    Stem Cell Reports, 2016;7(1):126-37.
    Species: Human
    Sample Types: Whole Cells
    Applications: IHC - PFA fixed
  8. Transcriptome sequencing wide functional analysis of human mesenchymal stem cells in response to TLR4 ligand
    Sci Rep, 2016;6(0):30311.
    Species: Human
    Sample Types: Whole Cells
    Applications: IHC - PFA fixed
  9. Ultra-Porous Nanoparticle Networks: A Biomimetic Coating Morphology for Enhanced Cellular Response and Infiltration
    Authors: N Nasiri, A Ceramidas, S Mukherjee, A Panneersel, DR Nisbet, A Tricoli
    Sci Rep, 2016;6(0):24305.
    Species: Mouse
    Sample Types: Whole Cells
    Applications: IHC Fresh
  10. Primary osteoblast-like cells from patients with end-stage kidney disease reflect gene expression, proliferation, and mineralization characteristics ex vivo.
    Authors: Pereira R, Delany A, Khouzam N, Bowen R, Freymiller E, Salusky I, Wesseling-Perry K
    Kidney Int, 2015;87(3):593-601.
    Species: Human
    Sample Types: Whole Cells
    Applications: IHC Not Specified
  11. PDL regeneration via cell homing in delayed replantation of avulsed teeth.
    Authors: Zhu W, Zhang Q, Zhang Y, Cen L, Wang J
    J Transl Med, 2015;13(0):357.
    Species: Canine
    Sample Types: Whole Tissue
    Applications: IHC - Paraffin embedded
  12. Identification of a cell-of-origin for fibroblasts comprising the fibrotic reticulum in idiopathic pulmonary fibrosis.
    Authors: Xia H, Bodempudi V, Benyumov A, Hergert P, Tank D, Herrera J, Braziunas J, Larsson O, Parker M, Rossi D, Smith K, Peterson M, Limper A, Jessurun J, Connett J, Ingbar D, Phan S, Bitterman P, Henke C
    Am J Pathol, 2014;184(5):1369-83.
    Species: Human
    Sample Types: Whole Cells
    Applications: IF
  13. Bone matrix, cellularity, and structural changes in a rat model with high-turnover osteoporosis induced by combined ovariectomy and a multiple-deficient diet.
    Authors: Govindarajan P, Bocker W, El Khassawna T, Kampschulte M, Schlewitz G, Huerter B, Sommer U, Durselen L, Ignatius A, Bauer N, Szalay G, Wenisch S, Lips K, Schnettler R, Langheinrich A, Heiss C
    Am J Pathol, 2014;184(3):765-77.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC
  14. Derivation and expansion using only small molecules of human neural progenitors for neurodegenerative disease modeling.
    Authors: Reinhardt P, Glatza M, Hemmer K, Tsytsyura Y, Thiel C, Hoing S, Moritz S, Parga J, Wagner L, Bruder J, Wu G, Schmid B, Ropke A, Klingauf J, Schwamborn J, Gasser T, Scholer H, Sterneckert J
    PLoS ONE, 2013;8(3):e59252.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  15. Dilatational band formation in bone.
    Authors: Poundarik, Atharva, Diab, Tamim, Sroga, Grazyna, Ural, Ani, Boskey, Adele L, Gundberg, Caren M, Vashishth, Deepak
    Proc Natl Acad Sci U S A, 2012;109(47):19178-83.
    Species: Human
    Sample Types: Whole Tissue
    Applications: IHC - Not specified
  16. Age-related changes in rat bone-marrow mesenchymal stem cell plasticity.
    Authors: Asumda FZ, Chase PB
    BMC Cell Biol., 2011;12(0):44.
    Species: Rat
    Sample Types: Whole Cells
    Applications: ICC
  17. The guidance of human mesenchymal stem cell differentiation in vitro by controlled modifications to the cell substrate.
    Authors: Curran JM, Chen R, Hunt JA
    Biomaterials, 2006;27(27):4783-93.
    Species: Human
    Sample Types: Whole Cells
    Applications: ICC
  18. A hybrid coating of biomimetic apatite and osteocalcin.
    Authors: Krout A, Wen HB, Hippensteel E, Li P
    J Biomed Mater Res A, 2005;73(4):377-87.
    Species: Rat
    Sample Types: Whole Tissue
    Applications: IHC

FAQs

No product specific FAQs exist for this product, however you may

View all Antibody FAQs

Cell and Tissue Staining Kits

Immunohistochemistry Reagents

Isotype Controls

Mouse IgG1 Isotype Control

Ctrl

Reconstitution Buffers

Secondary Antibodies

Reviews for Human/Rat Osteocalcin Antibody

There are currently no reviews for this product. Be the first to review Human/Rat Osteocalcin Antibody and earn rewards!

Have you used Human/Rat Osteocalcin Antibody?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review