Hydrogen Potassium ATPase Beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38674

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Hydrogen Potassium ATPase Beta Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Hydrogen Potassium ATPase Beta Antibody - BSA Free

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human liver.
Immunohistochemistry: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.
Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human stomach shows high expression.
Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining in human stomach and pancreas tissues using anti-ATP4B antibody. Corresponding ATP4B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human colon, kidney, liver and stomach using Anti-ATP4B antibody NBP2-38674 (A) shows similar protein distribution across tissues to independent antibody NBP2-32035 (B).
Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human kidney.
Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674]

Immunohistochemistry-Paraffin: Hydrogen Potassium ATPase Beta Antibody [NBP2-38674] - Staining of human colon.

Applications for Hydrogen Potassium ATPase Beta Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hydrogen Potassium ATPase Beta

The hydrogen/potassium ATPase, or gastric proton pump, belongs to a family of P-type cation-transporting ATPases. This family of ATPases shares a number of functional and structural similarities including the common feature of consisting of an alpha and beta subunit. Like the ubiquitous sodium/potassium ATPase, the hydrogen/potassium ATPase consists of a large transmembrane catalytic subunit, termed the alpha-subunit which contains sites for ATP binding and phosphorylation, and an associated smaller glycoprotein, termed the beta-subunit which may play a role in maintaining the structural and functional integrity of the complex.

Long Name

Potassium-transporting ATPase subunit beta

Alternate Names

ATP4B

Gene Symbol

ATP4B

UniProt

P51164 (Human)

Additional Hydrogen Potassium ATPase Beta Products

Product Documents for Hydrogen Potassium ATPase Beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Hydrogen Potassium ATPase Beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hydrogen Potassium ATPase Beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hydrogen Potassium ATPase Beta Antibody - BSA Free and earn rewards!

Have you used Hydrogen Potassium ATPase Beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies