IDH3A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54736

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to IDH3A(isocitrate dehydrogenase 3 (NAD+) alpha) The peptide sequence was selected from the N terminal of IDH3A. Peptide sequence MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: alpha, mitochondrial.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for IDH3A Antibody - BSA Free

Western Blot: IDH3A Antibody [NBP1-54736]

Western Blot: IDH3A Antibody [NBP1-54736]

Western Blot: IDH3A Antibody [NBP1-54736] - Reccomended Titration: 1.25 ug/ml Positive Control: Jurkat cell lysate IDH3A is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-54736]

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-54736]

Immunohistochemistry-Paraffin: IDH3A Antibody [NBP1-54736] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: IDH3A Antibody [NBP1-54736]

Western Blot: IDH3A Antibody [NBP1-54736]

Western Blot: IDH3A Antibody [NBP1-54736] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%
Western Blot: IDH3A Antibody [NBP1-54736]

Western Blot: IDH3A Antibody [NBP1-54736]

Western Blot: IDH3A Antibody [NBP1-54736] - Sample Tissue: Human HepG2 Antibody Dilution: 1.0 ug/ml

Applications for IDH3A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IDH3A

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. IDH3A is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase.Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase.

Alternate Names

EC 1.1.1, EC 1.1.1.41, H-IDH alpha, isocitrate dehydrogenase (NAD+) alpha chain, isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial, isocitrate dehydrogenase 3 (NAD+) alpha, Isocitric dehydrogenase subunit alpha, NAD(+)-specific ICDH subunit alpha, NAD(H)-specific isocitrate dehydrogenase alpha subunit, NAD+-specific ICDH

Gene Symbol

IDH3A

UniProt

Additional IDH3A Products

Product Documents for IDH3A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IDH3A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IDH3A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IDH3A Antibody - BSA Free and earn rewards!

Have you used IDH3A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...