![Western Blot: IER3 AntibodyBSA Free [NBP3-03948]](https://resources.rndsystems.com/images/products/IER3 Antibody-Western Blot-NBP3-03948-img0003.jpg "Western Blot: IER3 AntibodyBSA Free [NBP3-03948]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IER3 (NP_003888.2). GRPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSDYALDLSTFLQ
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for IER3 Antibody - BSA Free
Western Blot: IER3 AntibodyBSA Free [NBP3-03948]
Western Blot: IER3 Antibody [NBP3-03948] - Western blot analysis of extracts of various cell lines, using IER3 antibody (NBP3-03948) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.![Immunohistochemistry-Paraffin: IER3 Antibody - BSA Free [NBP3-03948]](https://resources.rndsystems.com/images/products/IER3-Antibody-Immunohistochemistry-Paraffin-NBP3-03948-img0002.jpg "Immunohistochemistry-Paraffin: IER3 Antibody - BSA Free [NBP3-03948]")
Immunohistochemistry-Paraffin: IER3 Antibody - BSA Free [NBP3-03948]
Immunohistochemistry-Paraffin: IER3 Antibody [NBP3-03948] - Paraffin-embedded human gastric cancer using IER3 antibody at dilution of 1:100 (40x lens).![Immunohistochemistry-Paraffin: IER3 Antibody - BSA Free [NBP3-03948]](https://resources.rndsystems.com/images/products/IER3-Antibody-Immunohistochemistry-Paraffin-NBP3-03948-img0001.jpg "Immunohistochemistry-Paraffin: IER3 Antibody - BSA Free [NBP3-03948]")
Immunohistochemistry-Paraffin: IER3 Antibody - BSA Free [NBP3-03948]
Immunohistochemistry-Paraffin: IER3 Antibody [NBP3-03948] - Paraffin-embedded mouse stomach using IER3 antibody at dilution of 1:100 (40x lens).Applications for IER3 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50-1:100
Western Blot
1:100 - 1:500
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: IER3
Alternate Names
DIF-2, DIF2GLY96, Differentiation-dependent gene 2 protein, expressed in pancreatic carcinoma, gly96, mouse, homolog of, IEX-1, IEX1death protein, IEX-1L, Immediate early protein GLY96, immediate early response 3, Immediate early response 3 protein, immediately early gene X-1, PRG1PACAP-responsive gene 1 protein, Protein DIF-2, Protein PRG1, radiation-inducible immediate-early gene IEX-1
Gene Symbol
IER3
Additional IER3 Products
Product Documents for IER3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for IER3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for IER3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review IER3 Antibody - BSA Free and earn rewards!
Have you used IER3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...