IFIT3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32500

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IFIT3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IFIT3 Antibody - BSA Free

Western Blot: IFIT3 Antibody [NBP2-32500]

Western Blot: IFIT3 Antibody [NBP2-32500]

Western Blot: IFIT3 Antibody [NBP2-32500] - Analysis in human cell lines SK-MEL-30 and MCF-7 using anti-IFIT3 antibody. Corresponding IFIT3 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/ Immunofluorescence: IFIT3 Antibody [NBP2-32500]

Immunocytochemistry/ Immunofluorescence: IFIT3 Antibody [NBP2-32500]

Immunocytochemistry/Immunofluorescence: IFIT3 Antibody [NBP2-32500] - Staining of human cell line A-431 shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500]

Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500]

Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500]

Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500]

Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500]

Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500]

Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500]

Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500]

Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP2-32500] - Staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells.

Applications for IFIT3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IFIT3

IFIT3, also known as IFIT4, IFI60, and RIGG, has been identified as a key element in the IFN-alpha anti-viral pathway. Additionally, IFIT3 binding negatively regulates the apoptotic effects of ISG54. IFIT3 is also a key target of STAT1, which is important in regulating IFN responses. One study has shown that expression of RIGG in a human monocytoma line led to growth arrest at the G1/S transition.

Alternate Names

CIG-49, GARG-49, IFI60Retinoic acid-induced gene G protein, IFIT-3, IFIT-4, IFIT4IFI-60K, interferon-induced protein with tetratricopeptide repeats 3, Interferon-induced protein with tetratricopeptide repeats 4Interferon-induced 60 kDa protein, IRG2, ISG60, ISG-60, RIG-GCIG49

Gene Symbol

IFIT3

Additional IFIT3 Products

Product Documents for IFIT3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IFIT3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for IFIT3 Antibody - BSA Free

Customer Reviews for IFIT3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IFIT3 Antibody - BSA Free and earn rewards!

Have you used IFIT3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies