IFT88 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86675

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all IFT88 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of IFT88. Peptide sequence: MMENVHLAPETDEDDLYSGFNDYNPAYDTEELENDTGFQQAVRTSHGRRP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for IFT88 Antibody - BSA Free

Western Blot: IFT88 Antibody [NBP2-86675]

Western Blot: IFT88 Antibody [NBP2-86675]

Western Blot: IFT88 Antibody [NBP2-86675] - WB Suggested Anti-Ift88 Antibody Titration: 1 ug/ml. Positive Control: Rat Brain lysate
Immunohistochemistry: IFT88 Antibody [NBP2-86675]

Immunohistochemistry: IFT88 Antibody [NBP2-86675]

Immunohistochemistry: IFT88 Antibody [NBP2-86675] - Immunohistochemistry with Testis tissue
Western Blot: IFT88 Antibody [NBP2-86675]

Western Blot: IFT88 Antibody [NBP2-86675]

Western Blot: IFT88 Antibody [NBP2-86675] - Host: Rabbit. Target Name: IFT88. Sample Tissue: Rat Rat Spleen. Antibody Dilution: 5ug/ml

Applications for IFT88 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IFT88

IFT88 encodes a member of the tetratrico peptide repeat (TPR) family. Mutations of a similar gene in mouse can cause polycystic kidney disease. Two transcript variants encoding distinct isoforms have been identified for this gene.

Alternate Names

D13S1056ETPR repeat protein 10, DAF19, hTg737, intraflagellar transport 88 homolog (Chlamydomonas), intraflagellar transport protein 88 homolog, MGC26259, polaris homolog, probe hTg737 (polycystic kidney disease, autosomal recessive), Recessive polycystic kidney disease protein Tg737 homolog, tetratricopeptide repeat domain 10, Tetratricopeptide repeat protein 10, TG737Tg737, TTC10

Gene Symbol

IFT88

Additional IFT88 Products

Product Documents for IFT88 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IFT88 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IFT88 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IFT88 Antibody - BSA Free and earn rewards!

Have you used IFT88 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies