IKBKAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56082

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IKBKAP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NLKDEVYHILKVLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLLD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IKBKAP Antibody - BSA Free

Western Blot: IKBKAP Antibody [NBP2-56082]

Western Blot: IKBKAP Antibody [NBP2-56082]

Western Blot: IKBKAP Antibody [NBP2-56082] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: IKBKAP Antibody [NBP2-56082]

Immunocytochemistry/ Immunofluorescence: IKBKAP Antibody [NBP2-56082]

Immunocytochemistry/Immunofluorescence: IKBKAP Antibody [NBP2-56082] - Staining of human cell line U-2 OS shows localization to cytosol.

Applications for IKBKAP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IKBKAP

The protein encoded by the IKBKAP gene is a scaffold protein and a regulator for 3 different kinases involved in proinflammatory signaling. This encoded protein can bind NF-kappa-B-inducing kinase (NIK) and IKKs through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia. (provided by RefSeq)

Alternate Names

DYS, elongator complex protein 1, ELP1DKFZp781H1425, FD, FLJ12497, IKAPdysautonomia (Riley-Day syndrome, hereditary sensory autonomic neuropathy typeIII), IkappaB kinase complex-associated protein, IKI3, IKK complex-associated protein, inhibitor of kappa light polypeptide gene enhancer in B-cells, kinasecomplex-associated protein, p150, TOT1

Gene Symbol

ELP1

Additional IKBKAP Products

Product Documents for IKBKAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IKBKAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IKBKAP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IKBKAP Antibody - BSA Free and earn rewards!

Have you used IKBKAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies