IL-10R alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-21308

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IL-10R alpha Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: IL-10R alpha Antibody [NBP3-21308] -

Immunocytochemistry/Immunofluorescence: IL-10R alpha Antibody [NBP3-21308] -

Staining of human cell line HDLM-2 shows localization to plasma membrane & cytosol.
Western Blot: IL-10R alpha Antibody [NBP3-21308] -

Western Blot: IL-10R alpha Antibody [NBP3-21308] -

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil

Applications for IL-10R alpha Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-10 R alpha

The IL-10 receptor, IL-10R, is a member of the class II subgroup of the cytokine receptor family and exhibits structural similarity to the interferon receptor. IL-10R is expressed in B cells and T helper cells, as well as in LPS-induced mouse fibroblasts. Overall, mouse IL-10R and human IL-10R share 60% sequence identity at the protein level. Stimulation with IL-10 leads to tyrosine phosphorylation of JAK1 and Tyk2, but not JAK2 or JAK3. In addition to its role as an antagonist of IFN-gamma-mediated macrophage activation, IL-10Ralpha transmits differentiation as well as proliferative signals. IL-10R is constitutively expressed on human natural killer (NK) cells and the direct binding of IL-10 potentiates cytokine production by human NK cells.

Long Name

Interleukin 10 Receptor alpha

Alternate Names

CDw210a, IL-10Ra, IL10R alpha, IL10RA

Gene Symbol

IL10RA

Additional IL-10 R alpha Products

Product Documents for IL-10R alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-10R alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IL-10R alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IL-10R alpha Antibody - BSA Free and earn rewards!

Have you used IL-10R alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Jak/STAT Signaling Pathway
Jak/STAT Signaling Pathway Thumbnail