IL-12 R beta 1 Antibody - BSA Free

Name: IL-12 R beta 1 Antibody - BSA Free
Brand: Novus Biologicals
SKU: NBP2-57287
Price: 559 USD
Availability: InStock

Novus Biologicals | Catalog # NBP2-57287

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

View all IL-12 R beta 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IL-12 R beta 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: IL-12 R beta 1 Antibody [NBP2-57287]

Immunocytochemistry/Immunofluorescence: IL-12 R beta 1 Antibody [NBP2-57287] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.

Applications for IL-12 R beta 1 Antibody - BSA Free

Application

Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Application Notes

ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-12 R beta 1

IL12RB1, also known as Interleukin-12 receptor subunit beta-1, has 3 isoforms, an isoform 1 that is 662 amino acid and 73 kDa, an isoform 2 that is 660 amino acid and 73 kDa, and an isoform3 that is 381 amino acid and 42 kDa; acts as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction; forms a functional, high affinity receptor for IL12 when combined with IL12RB2, and associates also with IL23R to form the interleukin-23 receptor which plays a role in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade. Current research is being pursued on this protein involvement in several diseases and disorders including immunodeficiency, mycobacterial and salmonella infections, salmonella gastroenteritis, mycobacterium infectious disease, myocarditis, lupus erythematosus, tuberculosis, sarcoidosis, neurological disorder, rheumatoid arthritis, gastroenteritis, asthma, and dermatitis. IL12RB1 protein involvement has been observed with relation to IL23R, IL23A, IL12A, IL12B, and IL12RB2 in the immune response IL-12 signaling pathway, immune response IL-22 signaling pathway, immune response IL-12-induced IFN-gamma production, cytokine production by Th17 cells in CF, and Jak-STAT signaling pathway.

Long Name

Interleukin 12 Receptor beta 1

Alternate Names

CD212, IL-12Rb1, IL12R beta 1, IL12RB1

Gene Symbol

IL12RB1

Additional IL-12 R beta 1 Products

Product Documents for IL-12 R beta 1 Antibody - BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IL-12 R beta 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.