IL-6R alpha Antibody (9S8Q5)

Name: IL-6R alpha Antibody (9S8Q5)
Brand: Novus Biologicals
SKU: NBP3-33510
Price: 449 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-33510

Submit a review

Product Documents

100% Guarantee

Product Specifications
Applications
Flow Cytometry
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot, ELISA, Flow Cytometry

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 9S8Q5

View all IL-6R alpha Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 20-357 of mouse IL-6R alpha (NP_034689.2).

Sequence:
LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit IL-6R alpha Antibody (9S8Q5) (NBP3-33510) is a monoclonal antibody validated for use in WB, ELISA and Flow. All Novus Biologicals antibodies are covered by our 100% guarantee.

Applications for IL-6R alpha Antibody (9S8Q5)

Application

Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Flow Cytometry

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
Spillover Popups - Visualize the spectra of individual fluorochromes
Antigen Density Selector - Match fluorochrome brightness with antigen density

Build Your Panel Now

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: IL-6R alpha

Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in immune response. The protein encoded by this gene is a subunit of the receptor complex for IL6. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Long Name

Interleukin 6 Receptor alpha

Alternate Names

CD126, IL-6 R alpha, IL-6Ra, IL6R, IL6R alpha

Gene Symbol

IL6R

Additional IL-6R alpha Products

Product Documents for IL-6R alpha Antibody (9S8Q5)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-6R alpha Antibody (9S8Q5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.