IL-7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83111

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IL-7 Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111]

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111]

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111] - Staining of human lymph node shows moderate cytoplasmic and membranous positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111]

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111]

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111]

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111]

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111]

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111]

Immunohistochemistry-Paraffin: IL-7 Antibody [NBP1-83111] - Staining of human skin shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

Applications for IL-7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-7

Interleukin-7 (IL-7, previously known as lymphopoietin-1 and pre-B-cell growth factor) is a hematopoietic growth factor that stimulates early B and T cells. It can also co-stimulate the proliferation of mature T cells with other factors such as ConA (concanavalin A) and IL-2. IL-7 can induce the formation of lymphokine-activated killer (LAK) cells, it also plays a role in the development of cytotoxic T lymphocytes (CTL). IL-7 can stimulate the production of pro-inflammatory cytokines and enhance the tumoricidal activity of monocytes/macrophages. It is produced by thymic stromal cells, spleen cells and keratinocytes. Human and murine IL-7 show cross-species reactivity.

Long Name

Interleukin 7

Alternate Names

IL7, Lymphopoietin-1, PBGF

Gene Symbol

IL7

Additional IL-7 Products

Product Documents for IL-7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for IL-7 Antibody - BSA Free

Customer Reviews for IL-7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IL-7 Antibody - BSA Free and earn rewards!

Have you used IL-7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies