Importin-7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87880

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Importin-7 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Importin-7 Antibody - BSA Free (NBP1-87880) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Importin-7 Antibody - BSA Free

Immunohistochemistry-Paraffin: Importin-7 Antibody [NBP1-87880]

Immunohistochemistry-Paraffin: Importin-7 Antibody [NBP1-87880]

Immunohistochemistry-Paraffin: Importin-7 Antibody [NBP1-87880] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Importin-7 Antibody - BSA Free Western Blot: Importin-7 Antibody - BSA Free [NBP1-87880]

Western Blot: Importin-7 Antibody - BSA Free [NBP1-87880]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Importin-7 Antibody - BSA Free Western Blot: Importin-7 Antibody - BSA Free [NBP1-87880]

Western Blot: Importin-7 Antibody - BSA Free [NBP1-87880]

Analysis in human cell line RH-30.

Applications for Importin-7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Importin-7

The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. Similar to importin-beta, this protein prevents the activation of Ran's GTPase by RanGAP1 and inhibits nucleotide exchange on RanGTP, and also binds directly to nuclear pore complexes where it competes for binding sites with importin-beta and transportin. This protein has a Ran-dependent transport cycle and it can cross the nuclear envelope rapidly and in both directions. At least four importin beta-like transport receptors, namely importin beta itself, transportin, RanBP5 and RanBP7, directly bind and import ribosomal proteins. [provided by RefSeq]

Alternate Names

FLJ14581, Imp7MGC138673, importin 7, RAN binding protein 7, Ran-binding protein 7, RanBP7, RANBP7importin-7

Gene Symbol

IPO7

Additional Importin-7 Products

Product Documents for Importin-7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Importin-7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Importin-7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Importin-7 Antibody - BSA Free and earn rewards!

Have you used Importin-7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Importin-7 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I have noticed that you have a rabbit polyclonal anti-human Ipo7. I am searching for a primary mouse/goat ab anti-human Importin7 (Ipo7) that is suitable for IF, WB application. Could you please tell me if you have something that is suitable for me?

    A: NBP1-87880 suits all of your needs but is a rabbit host. I am not sure if this will work for you or not. NB100-1081 is our only goat host antibody and it has been validated in Western blot and ELISA. It is expected to work in ICC though, since it is known to recognize the protein in its native form. Please let me know if you have further questions or need further clarification.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies