Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47418

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Importin alpha 5/KPNA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MEMAPGGVITSDMIEMIFSKSPEQQLSATQK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Western Blot: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/ Immunofluorescence: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Immunocytochemistry/ Immunofluorescence: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Immunocytochemistry/Immunofluorescence: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418] - Staining human cerebellum shows moderate nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418]

Immunohistochemistry-Paraffin: Importin alpha 5/KPNA1/SRP1 Antibody [NBP2-47418] - Staining in human testis and pancreas tissues using anti-KPNA1 antibody. Corresponding KPNA1 RNA-seq data are presented for the same tissues.

Applications for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Importin alpha 5/KPNA1

Recombination activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombination, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombination process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-DNA break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombination

Alternate Names

IPOA5, KPNA1, NPI-1, RCH2, SRP1

Gene Symbol

KPNA1

Additional Importin alpha 5/KPNA1 Products

Product Documents for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free and earn rewards!

Have you used Importin alpha 5/KPNA1/SRP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies