Importin4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56986

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Importin4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VRDNICGALARLLMASPTRKPEPQVLAALLHALPLKEDLEEWVTIGRLFSFLYQSSPDQVIDVAPELLRICSLILADNKIPPD

Reactivity Notes

Mouse 80%, Rat 83%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Importin4 Antibody - BSA Free

Western Blot: Importin4 Antibody [NBP2-56986]

Western Blot: Importin4 Antibody [NBP2-56986]

Western Blot: Importin4 Antibody [NBP2-56986] - Analysis using Anti-IPO4 antibody NBP2-56986 (A) shows similar pattern to independent antibody NBP1-89841 (B).
Immunocytochemistry/ Immunofluorescence: Importin4 Antibody [NBP2-56986]

Immunocytochemistry/ Immunofluorescence: Importin4 Antibody [NBP2-56986]

Immunocytochemistry/Immunofluorescence: Importin4 Antibody [NBP2-56986] - Staining of human cell line MCF7 shows localization to cytosol.

Applications for Importin4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Importin4

IPO4, also known as Importin-4, consists of a 1,081 amino acid long isoform that is 119 kDa and a shorter 1,083 amino acid isoform that is 119 kDa, and is a nuclear transport receptor for localization signals in between the nucleus and the cytoplasm. This protein has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E. Disease research is currently being studied with relation to IPO4 and leukemia, hypoxia, and pancreatic cancer.

Alternate Names

imp4b, importin 4, importin-4

Gene Symbol

IPO4

Additional Importin4 Products

Product Documents for Importin4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Importin4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Importin4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Importin4 Antibody - BSA Free and earn rewards!

Have you used Importin4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies