Insulysin/IDE Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03392

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse

Applications

Knockout Validated, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Insulysin/IDE (NP_004960.2). MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Insulysin/IDE Antibody - BSA Free

Western Blot: Insulysin/IDE AntibodyBSA Free [NBP3-03392]

Western Blot: Insulysin/IDE AntibodyBSA Free [NBP3-03392]

Western Blot: Insulysin/IDE Antibody [NBP3-03392] - Analysis of extracts from normal (control) and IDE knockout (KO) HeLa cells, using Insulysin/IDE antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Western Blot: Insulysin/IDE AntibodyBSA Free [NBP3-03392]

Western Blot: Insulysin/IDE AntibodyBSA Free [NBP3-03392]

Western Blot: Insulysin/IDE Antibody [NBP3-03392] - Analysis of extracts of various cell lines, using Insulysin/IDE antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Insulysin/IDE Antibody - BSA Free

Immunohistochemistry: Insulysin/IDE Antibody - BSA Free [Insulysin/IDE] -

Immunohistochemistry: Insulysin/IDE Antibody - BSA Free [Insulysin/IDE] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] Insulysin/IDE Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Insulysin/IDE Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Insulysin/IDE Antibody - BSA Free [Insulysin/IDE] -

Immunocytochemistry/ Immunofluorescence: Insulysin/IDE Antibody - BSA Free [Insulysin/IDE] - Immunofluorescence analysis of A549 cells using [KO Validated] Insulysin/IDE Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Insulysin/IDE Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:100

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Insulysin/IDE

Insulysin was identified nearly a century ago as an enzyme responsible for the degradation of insulin in cells, although the precise interactions between insulin and insulysin remain elusive. Human insulysin was cloned in 1988, and shown to be a 118 kDa protein that exists primarily as a homodimer, and perhaps also complexed with other molecules. The sequence is well conserved between humans, rats and mice, and the antibody recognizes these species. Insulysin is a metalloproteinase of the clan ME, family M16, which contains an active site HxxEH, a reversal of the canonical HExxH zinc binding motif. Considered a zinc metalloproteinase, the activity of insulysin can be blocked with EDTA or 1-10 phenanthroline. In addition to the active metalloproteinase domain, insulysin contains a second metalloproteinase site which is considered catalytically inactive, and is thought to assist in substrate binding. Insulysin is most closely related to the bacterial proteinase pitrilysin, (the human orthologue of which appears to be MPRP1) and the mammalian proteinsae nardilysin. Generally thought to be a cytoplasmic protein, insulysin has been isolated from many different tissues and cell lines, and can degrade intact insulin, insulin B chain, glucagon, denatured hemoglobin, alpha amyloid protein, TGF alpha and amylin. Recent work implicates insulysin in clearing beta amyloid plaques from the brain, and has generated much interest in Alzheimer's disease research. The pH optimum for insulysin is basic, pH 8.5, which also distinguishes it from other metalloproteinases. Insulin degrading enzyme (IDE) has a preferential affinity for insulin such that the presence of insulin will inhibit IDE mediated degradation of other substrates. IDE degrades a variety of other peptides including atrial natriuretic peptide and amylin. IDE catabolizes A beta and has been implicated as a candidate enzyme responsible for the degradation and clearance of A beta in the brain. IDE has also been shown to degrade the APP intracellular domain (AICD), a product of gamma secretase cleaved APP that may function in nuclear signaling.

Long Name

Insulin Degrading Enzyme

Alternate Names

IDE, INSDEGM, Insulinase

Gene Symbol

IDE

Additional Insulysin/IDE Products

Product Documents for Insulysin/IDE Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Insulysin/IDE Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Insulysin/IDE Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Insulysin/IDE Antibody - BSA Free and earn rewards!

Have you used Insulysin/IDE Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies