integrin beta 4 binding protein Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13954

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27119753).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for integrin beta 4 binding protein Antibody - BSA Free

Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954]

Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954]

Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunocytochemistry/ Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunocytochemistry/Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.
Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954]

Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954]

Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954]

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human Skin shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] -

Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Analysis in human skin and skeletal muscle tissues using NBP2-13954 antibody. Corresponding EIF6 RNA-seq data are presented for the same tissues.

Applications for integrin beta 4 binding protein Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: integrin beta 4 binding protein

Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

b(2)gcn, B(2)GCN homolog, B4 integrin interactor, CAB, EIF3Ap27(BBP), eIF-6, eukaryotic translation initiation factor 3A, eukaryotic translation initiation factor 6, ITGB4BPintegrin beta 4 binding protein, p27 beta-4 integrin-binding protein, p27BBP

Gene Symbol

EIF6

Additional integrin beta 4 binding protein Products

Product Documents for integrin beta 4 binding protein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for integrin beta 4 binding protein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for integrin beta 4 binding protein Antibody - BSA Free

Customer Reviews for integrin beta 4 binding protein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review integrin beta 4 binding protein Antibody - BSA Free and earn rewards!

Have you used integrin beta 4 binding protein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...