Integrin beta 5 Antibody (2C4) - Azide and BSA Free
Novus Biologicals | Catalog # H00003693-M01
![Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01]](https://resources.rndsystems.com/images/products/Integrin-beta-5-Antibody-2C4-Western-Blot-H00003693-M01-img0008.jpg "Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot, ELISA, Flow Cytometry, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 2C4
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
ITGB5 (NP_002204, 421 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA
Specificity
ITGB5 - integrin, beta 5
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for Integrin beta 5 Antibody (2C4) - Azide and BSA Free
Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01]
Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01] - Analysis of ITGB5 expression in transfected 293T cell line by ITGB5 monoclonal antibody (M01), clone 2C4.Lane 1: ITGB5 transfected lysate(88.1 KDa).Lane 2: Non-transfected lysate.![Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01]](https://resources.rndsystems.com/images/products/Integrin-beta-5-Antibody-2C4-Western-Blot-H00003693-M01-img0005.jpg "Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01]")
Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01]
Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01] - Analysis of ITGB5 over-expressed 293 cell line, cotransfected with ITGB5 Validated Chimera RNAi ( Cat # H00003693-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ITGB5 monoclonal antibody (M01), clone 2C4 (Cat # H00003693-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.![Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01]](https://resources.rndsystems.com/images/products/Integrin-beta-5-Antibody-2C4-Western-Blot-H00003693-M01-img0007.jpg "Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01]")
Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01]
Western Blot: Integrin beta 5 Antibody (2C4) [H00003693-M01] - ITGB5 monoclonal antibody (M01), clone 2C4 Analysis of ITGB5 expression in HeLa.![ELISA: Integrin beta 5 Antibody (2C4) [H00003693-M01]](https://resources.rndsystems.com/images/products/Integrin-beta-5-Antibody-2C4-ELISA-H00003693-M01-img0009.jpg "ELISA: Integrin beta 5 Antibody (2C4) [H00003693-M01]")
ELISA: Integrin beta 5 Antibody (2C4) [H00003693-M01]
ELISA: Integrin beta 5 Antibody (2C4) [H00003693-M01] - Detection limit for recombinant GST tagged ITGB5 is approximately 0.3ng/ml as a capture antibody.Applications for Integrin beta 5 Antibody (2C4) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Flow Cytometry Panel Builder
Bio-Techne Knows Flow Cytometry
Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.
Advanced Features
- Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
- Spillover Popups - Visualize the spectra of individual fluorochromes
- Antigen Density Selector - Match fluorochrome brightness with antigen density
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: Integrin beta 5
Additional Integrin beta 5 Products
Product Documents for Integrin beta 5 Antibody (2C4) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Integrin beta 5 Antibody (2C4) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Integrin beta 5 Antibody (2C4) - Azide and BSA Free
Powered by Bioz
Customer Reviews for Integrin beta 5 Antibody (2C4) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review Integrin beta 5 Antibody (2C4) - Azide and BSA Free and earn rewards!
Have you used Integrin beta 5 Antibody (2C4) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- 7-Amino Actinomycin D (7-AAD) Cell Viability Flow Cytometry Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Extracellular Membrane Flow Cytometry Protocol
- Flow Cytometry Protocol for Cell Surface Markers
- Flow Cytometry Protocol for Staining Membrane Associated Proteins
- Flow Cytometry Staining Protocols
- Flow Cytometry Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Intracellular Flow Cytometry Protocol Using Alcohol (Methanol)
- Intracellular Flow Cytometry Protocol Using Detergents
- Intracellular Nuclear Staining Flow Cytometry Protocol Using Detergents
- Intracellular Staining Flow Cytometry Protocol Using Alcohol Permeabilization
- Intracellular Staining Flow Cytometry Protocol Using Detergents to Permeabilize Cells
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Propidium Iodide Cell Viability Flow Cytometry Protocol
- Protocol for Liperfluo
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Characterization of Human Th22 Cells
- Protocol for the Characterization of Human Th9 Cells
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Protocol: Annexin V and PI Staining by Flow Cytometry
- Protocol: Annexin V and PI Staining for Apoptosis by Flow Cytometry
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Fluorokine Flow Cytometry Kits
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...
Associated Pathways
Blood-Brain Barrier Pathway: Anatomy
