IPPK Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86712

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IPPK Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IPPK Antibody - BSA Free

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712]

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712]

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712]

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712]

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712]

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712]

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712] - Staining of human liver very weak cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712]

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712]

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712] - Staining of human pancreas shows no positivity in exocrine or endocrine glandular cells as expected.
IPPK Antibody - BSA Free Western Blot: IPPK Antibody - BSA Free [NBP1-86712]

Western Blot: IPPK Antibody - BSA Free [NBP1-86712]

Analysis in human cell line BEWO.
IPPK Antibody - BSA Free Western Blot: IPPK Antibody - BSA Free [NBP1-86712]

Western Blot: IPPK Antibody - BSA Free [NBP1-86712]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Applications for IPPK Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IPPK

Phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 isinvolved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. Italso protects cells from TNF-alpha-induced apoptosis

Alternate Names

bA476B13.1, bA476B13.1 (novel protein), C9orf12, chromosome 9 open reading frame 12, EC 2.7.1.158, FLJ13163, inositol 13,45,6-pentakisphosphate 2-kinase, Inositol-13,45,6-pentakisphosphate 2-kinase, inositol-pentakisphosphate 2-kinase, Ins(13,45,6)P5 2-kinase, InsP5 2-kinase, INSP5K2, IP5K, IPK1, IPK1 homolog, KIAA0699

Gene Symbol

IPPK

Additional IPPK Products

Product Documents for IPPK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IPPK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IPPK Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IPPK Antibody - BSA Free and earn rewards!

Have you used IPPK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies