IRE1 alpha Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-95252

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all IRE1 alpha Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 286-435 of human IRE1 alpha (NP_001424.3). VGKYSTSLYASPSMVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDVKFDPGLKSKNKLNYLRNYWLLIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVINLVDQTSENAPTTVSRDVEEKPAHAPARPEA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

110 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for IRE1 alpha Antibody - Azide and BSA Free

Western Blot: IRE1 alpha AntibodyAzide and BSA Free [NBP2-95252]

Western Blot: IRE1 alpha AntibodyAzide and BSA Free [NBP2-95252]

Western Blot: IRE1 alpha Antibody [NBP2-95252] - Analysis of extracts of various cell lines, using IRE1 alpha antibody (NBP2-95252) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
IRE1 alpha Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: IRE1 alpha Antibody - Azide and BSA Free [IRE1 alpha] -

Immunocytochemistry/ Immunofluorescence: IRE1 alpha Antibody - Azide and BSA Free [IRE1 alpha] - Immunofluorescence analysis of U2OS cells using IRE1 alpha Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: IRE1 alpha Antibody - Azide and BSA Free [NBP2-95252]

Immunohistochemistry-Paraffin: IRE1 alpha Antibody - Azide and BSA Free [NBP2-95252]

Immunohistochemistry-Paraffin: IRE1 alpha Antibody [NBP2-95252] - Rat pancreas using IRE1 alpha Rabbit pAb (NBP2-95252) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Western Blot: IRE1 alpha AntibodyAzide and BSA Free [NBP2-95252]

Western Blot: IRE1 alpha AntibodyAzide and BSA Free [NBP2-95252]

Western Blot: IRE1 alpha Antibody [NBP2-95252] - Analysis of extracts of 293T cells, using IRE1 alpha antibody (NBP2-95252) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 120s.
Immunohistochemistry-Paraffin: IRE1 alpha Antibody - Azide and BSA Free [NBP2-95252]

Immunohistochemistry-Paraffin: IRE1 alpha Antibody - Azide and BSA Free [NBP2-95252]

Immunohistochemistry-Paraffin: IRE1 alpha Antibody [NBP2-95252] - Human breast cancer using IRE1 alpha Rabbit pAb (NBP2-95252) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: IRE1 alpha Antibody - Azide and BSA Free [NBP2-95252]

Immunohistochemistry-Paraffin: IRE1 alpha Antibody - Azide and BSA Free [NBP2-95252]

Immunohistochemistry-Paraffin: IRE1 alpha Antibody [NBP2-95252] - Mouse kidney using IRE1 alpha Rabbit pAb (NBP2-95252) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: IRE1 alpha Antibody - Azide and BSA Free [NBP2-95252]

Immunohistochemistry-Paraffin: IRE1 alpha Antibody - Azide and BSA Free [NBP2-95252]

Immunohistochemistry-Paraffin: IRE1 alpha Antibody [NBP2-95252] - Rat kidney using IRE1 alpha Rabbit pAb (NBP2-95252) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
IRE1 alpha Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: IRE1 alpha Antibody - Azide and BSA Free [IRE1 alpha] -

Immunocytochemistry/ Immunofluorescence: IRE1 alpha Antibody - Azide and BSA Free [IRE1 alpha] - Immunofluorescence analysis of PC-12 cells using IRE1 alpha Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
IRE1 alpha Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: IRE1 alpha Antibody - Azide and BSA Free [IRE1 alpha] -

Immunocytochemistry/ Immunofluorescence: IRE1 alpha Antibody - Azide and BSA Free [IRE1 alpha] - Immunofluorescence analysis of NIH/3T3 cells using IRE1 alpha Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
IRE1 alpha Antibody - Azide and BSA Free

Immunohistochemistry: IRE1 alpha Antibody - Azide and BSA Free [IRE1 alpha] -

Immunohistochemistry: IRE1 alpha Antibody - Azide and BSA Free [IRE1 alpha] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using IRE1 alpha Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for IRE1 alpha Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: IRE1 alpha

Accumulation of misfolded proteins in the endoplasmic reticulum (ER) activates the unfolded protein response (UPR) and upregulates ER molecular chaperones in order to cope with ER stress. UPR is initiated by three ER-localized protein sensors: PERK (PKR-like ER kinase), ATF (activating transcription factor 6), and IRE1 alpha (inositol-requiring enzyme 1 alpha) (1). IRE1 alpha is correlated with X-box binding protein (XBP1) as a potent UPR transcriptional activator (2).

Transcriptional activation of UPR-responsive genes are regulated by the ATF6 and IRE1-XBP1 pathways, which are often regulated by HIFs and contribute to cell survival under ER hypoxic stress (3). UPR signaling can a) inhibit protein translation to restore cell function, b) activate signaling to increase production of molecular chaperones for protein folding, and c) initiate ubiquitination signaling that leads to degradation of misfolded proteins in ER.

IRE1 alpha acts as the sensor of unfolded proteins in the ER. IRE1 alpha not only promotes cell survival but can initiate apoptosis when accumulation of unfolded proteins in the ER causes stress. IRE1 alpha is essential for viability under stress conditions that cause unfolded proteins to accumulate in the ER. IRE1 alpha is a transmembrane protein that has both serine-threonine kinase and endoribonuclease activities and has a theoretical molecular weight of 110 kDa. When detecting phospho-IRE1 alpha, it is recommended to normalize its band intensity with total IRE1 alpha.

References

1. Zheng, W., Xie, W., Yin, D., Luo, R., Liu, M., & Guo, F. (2019). ATG5 and ATG7 induced autophagy interplays with UPR via PERK signaling. Cell Commun Signal, 17(1), 42. doi:10.1186/s12964-019-0353-3

2. Cho, Y. M., Kim, D. H., Lee, K. H., Jeong, S. W., & Kwon, O. J. (2018). The IRE1alpha-XBP1s pathway promotes insulin-stimulated glucose uptake in adipocytes by increasing PPARgamma activity. Exp Mol Med, 50(8), 102. doi:10.1038/s12276-018-0131-0

3. Xia, Z., Wu, S., Wei, X., Liao, Y., Yi, P., Liu, Y.,... Liu, J. (2019). Hypoxic ER stress suppresses beta-catenin expression and promotes cooperation between the transcription factors XBP1 and HIF1alpha for cell survival. J Biol Chem, 294(37), 13811-13821. doi:10.1074/jbc.RA119.008353

Long Name

Serine/threonine-protein kinase/endoribonuclease IRE1

Alternate Names

ERN1, hIRE1p, IRE1, Ire1-alpha

Gene Symbol

ERN1

Additional IRE1 alpha Products

Product Documents for IRE1 alpha Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IRE1 alpha Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for IRE1 alpha Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review IRE1 alpha Antibody - Azide and BSA Free and earn rewards!

Have you used IRE1 alpha Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies