Irisin, also known as FNDC5, is a peptide hormone that is upregulated in skeletal muscle and subcutaneous adipose tissue during exercise. It induces expression of the mitochondrial proteins PPAR-gamma coactivator 1 alpha (PGC1a) and uncoupling protein-1 (UCP1). It contributes to the regulation of diabetes and obesity by inducing the transition of white adipose tissue into more metabolically active beige adipose tissue. Irisin also regulates neuronal cell differentiation, neurite outgrowth, and osteoblast differentiation.
Irisin/FNDC5 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-14024
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Human
Predicted:
Rat (100%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence
Cited:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence, Immunocytochemistry/ Immunofluorescence, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR
Reactivity Notes
Mouse reactivity reported from a verified customer review.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Irisin/FNDC5 Antibody - BSA Free
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024]
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Specific positive staining can be observed in a subpopulation of mouse gastric mucosa cells. Green is FNDC5. Image from verified customer review.Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024]
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human skeletal muscle shows granular cytoplasmic positivity in myocytes.Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] -
Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Positive immunohistochemical (IHC) reactions (brown color) indicating strong irisin expression in the apical parts of cancer cells & vesicles; magnification x400. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35408891), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] -
Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of malignancy (G) of breast cancer (BC; (B)—G1; (C)—G2, in apical parts of cells; (D)—G3) with Ki-67 (E) & PGC-1 alpha (F); magnification x200. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/35408891), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Irisin/FNDC5 Antibody - BSA Free
Application
Recommended Usage
Immunofluorescence
Reported in scientific literature (PMID:31614634).
Immunohistochemistry
1:20 - 1:50
Immunohistochemistry-Paraffin
1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 review rated 5 using NBP2-14024 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Irisin/FNDC5
Long Name
Fibronectin Type III Domain Containing 5
Alternate Names
FNDC5, FRCP2
Gene Symbol
FNDC5
Additional Irisin/FNDC5 Products
Product Documents for Irisin/FNDC5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Irisin/FNDC5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Irisin/FNDC5 Antibody - BSA Free
Customer Reviews for Irisin/FNDC5 Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used Irisin/FNDC5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: Stomach tissueSpecies: MouseVerified Customer | Posted 01/23/2019Specific positive staining can be observed in a subpopulation of mouse gastric mucosa cells. Green is FNDC5. This antibody is very good.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...