ITIH2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-31750
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Mouse
Predicted:
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry-Frozen, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRET
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for ITIH2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: ITIH2 Antibody [NBP2-31750]
Immunocytochemistry/Immunofluorescence: ITIH2 Antibody [NBP2-31750] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus.Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750]
Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.Immunocytochemistry/ Immunofluorescence: ITIH2 Antibody [NBP2-31750]
ITIH2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31750-img0018.jpgImmunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750]
Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human endometrium shows no positivity in glandular cells as expected.Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750]
Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human duodenum shows moderate positivity in plasma in blood vessels.Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750]
Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human fallopian tube shows strong positivity in plasma in blood vessels.Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750]
Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human endometrium shows no positivity in glandular cells as expected.Immunocytochemistry/ Immunofluorescence: ITIH2 Antibody - BSA Free [NBP2-31750] -
HC-HA formation after LPS or PA injury. a-c. Abundance of heavy chain (HC)-linked HA in lung lysates detected by western blot using I alpha I antibody (recognizing HC) on lungs before (−) and after (+) hyaluronidase (HAse), which releases HC linked to HA. Each lane represents an individual mouse lung exposed to intratracheally instilled LPS (20 μg; a) or Pseudomonas aeruginosa (PA, 2*106 CFU; b) or control PBS for the indicated time, noted as days post instillation (dpi). Lung HC abundance was expressed relative to that of total protein, measured by densitometry (a-b). c. Exclusive role of TSG-6 in forming HC-HA was confirmed using wild type (WT), heterozygous (HT), and knockout (KO) for TSG-6. d-e. msTNF alpha and msTSG-6 expression levels measured by qPCR in whole lung following LPS. Data in a-b and d-e analyzed by ANOVA with Tukey’s multiple comparisons; **P < 0.01, ***P < 0.001, ****P <.0001. f. Immunofluorescence images of HA and HC localization in formalin-fixed, paraffin-embedded lung sections from control (0 dpi) and PA-injured (1 and 2 dpi) mice, using antibodies against HA binding protein (red) or HC2 (green), and staining for nuclei with DAPI (Blue). Staining control provided in the last row, using secondary antibody only. Note HC-HA co-localization in the peri-broncho (Br)-vascular (V) interstitium (white arrow); scale bar 50 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/29855321), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for ITIH2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ITIH2
Long Name
Inter-Alpha-Trypsin Inhibitor Heavy Chain 2
Alternate Names
H2P, IGHEP2, Inter-Alpha (Globulin) Inhibitor H2, Intin2, ITI Heavy Chain H2, ITI-H2, ITI-HC2, SHAP
Gene Symbol
ITIH2
UniProt
Additional ITIH2 Products
Product Documents for ITIH2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ITIH2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for ITIH2 Antibody - BSA Free
Customer Reviews for ITIH2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ITIH2 Antibody - BSA Free and earn rewards!
Have you used ITIH2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...