KAL1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03937

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all KAL1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human KAL1 (NP_000207.2). LEVKWSSKFNISIEPVIYVVQRRWNYGIHPSEDDATHWQTVAQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPANLRLAN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KAL1 Antibody - Azide and BSA Free

Western Blot: KAL1 AntibodyAzide and BSA Free [NBP3-03937]

Western Blot: KAL1 AntibodyAzide and BSA Free [NBP3-03937]

Western Blot: KAL1 Antibody [NBP3-03937] - Analysis of extracts of various cell lines, using KAL1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 5s.
KAL1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: KAL1 Antibody - Azide and BSA Free [NBP3-03937] -

Immunocytochemistry/ Immunofluorescence: KAL1 Antibody - Azide and BSA Free [NBP3-03937] - Immunofluorescence analysis of paraffin-embedded rat brain using KAL1 Rabbit pAb (A16389) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
KAL1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: KAL1 Antibody - Azide and BSA Free [NBP3-03937] -

Immunocytochemistry/ Immunofluorescence: KAL1 Antibody - Azide and BSA Free [NBP3-03937] - Immunofluorescence analysis of paraffin-embedded mouse brain using KAL1 Rabbit pAb (A16389) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
KAL1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: KAL1 Antibody - Azide and BSA Free [NBP3-03937] -

Immunocytochemistry/ Immunofluorescence: KAL1 Antibody - Azide and BSA Free [NBP3-03937] - Immunofluorescence analysis of paraffin-embedded mouse brain using KAL1 Rabbit pAb (A16389) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for KAL1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: KAL1

KAL1 is a gene which codes for a protein that is expressed in the cerebellum and plays an important role in the patterning of cell collaterals to the olfactory cortex while also working as a chemo-attractant for fetal olfactory cells, with a length of 680 amino acids, and a weight of approximately 76 kDa. Studies are being conducted on diseases and disorders related to this gene including Kallmann syndrome, x-linked ichtyhosis, typhus, vesicoureteral reflux, delayed puberty, tooth agenesis, gonadotropin deficiency, charge syndrome, and atopic dermatitis. KAL1 has also been shown to have interactions with SDC2, FGFR1, FGF2, and FGFR2.

Long Name

Kallmann Syndrome 1 Sequence

Alternate Names

ADMLX, ANOS1, Anosmin 1, HH1, HHA, KAL, KALIG-1, KMS

Gene Symbol

ANOS1

Additional KAL1 Products

Product Documents for KAL1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KAL1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for KAL1 Antibody - Azide and BSA Free

Customer Reviews for KAL1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review KAL1 Antibody - Azide and BSA Free and earn rewards!

Have you used KAL1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies