Catalog Number: 3564
Biological Activity
Potent blocker of voltage-sensitive K+ channels (IC50 values are 0.1, 1.1 and 25 nM for KV1.3, KV1.1 and KV1.2 channels) respectively). Also inhibits Ca2+-activated K+ channels.
Technical Data
  • M.Wt:
    4149.94
  • Formula:
    C171H283N55O49S8
  • Sequence:
    GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK

    (Modifications: Disulfide bridge between 8 - 28, 14 - 33, 18 - 35)

  • Solubility:
    Soluble to 2 mg/ml in water
  • Storage:
    Store at -20°C
  • CAS No:
    145199-73-1
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Synthesis and characterization of kaliotoxin: is the 26-32 sequence essential for potassium channel recognition?
    Romi et al.
    J.Biol.Chem., 1993;268:26302
  2. Distribution in rat brain of binding sites of kaliotoxin, a blocker of Kv1.1and Kv1.3 α-subunits.
    Mourre et al.
    J.Pharmacol.Exp.Ther., 1999;291:943
  3. High-resolution 3D structure determination of kaliotoxin by solid-state NMR spectroscopy.
    Korukottu et al.
    PLoS ONE, 2008;3:e2359

Have you used Kaliotoxin?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

Feedback

Customer Information