Kallikrein 7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38950

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Kallikrein 7 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: AHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Kallikrein 7 Antibody - BSA Free (NBP2-38950) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Kallikrein 7 Antibody - BSA Free

Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950]

Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950]

Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950] - Analysis in human skin and skeletal muscle tissues. Corresponding KLK7 RNA-seq data are presented for the same tissues.
Western Blot: Kallikrein 7 Antibody [NBP2-38950]

Western Blot: Kallikrein 7 Antibody [NBP2-38950]

Western Blot: Kallikrein 7 Antibody [NBP2-38950] - Analysis in control (vector only transfected HEK293T lysate) and KLK7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950]

Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950]

Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950]

Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950]

Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950] - Staining of human skin shows weak to moderate cytoplasmic positivity in keratinocytes.
Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950]

Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950]

Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in granulocytes.
Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950]

Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950]

Immunohistochemistry-Paraffin: Kallikrein 7 Antibody [NBP2-38950] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Applications for Kallikrein 7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kallikrein 7

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its encoded enzyme is thought to be involved in the proteolysis of intercellular cohesive structures preceding desquamation, which is the shedding of the outermost layer of the epidermis. Alternative splicing of this gene results in two transcript variants encoding the same protein.

Alternate Names

KLK7

Gene Symbol

KLK7

UniProt

P49862

Additional Kallikrein 7 Products

Product Documents for Kallikrein 7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Kallikrein 7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kallikrein 7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kallikrein 7 Antibody - BSA Free and earn rewards!

Have you used Kallikrein 7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies