KCNA10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10357

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KCNA10 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNA10 (NP_005540). Peptide sequence DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KCNA10 Antibody - BSA Free

Immunohistochemistry-Paraffin: KCNA10 Antibody [NBP3-10357]

Immunohistochemistry-Paraffin: KCNA10 Antibody [NBP3-10357]

Immunohistochemistry-Paraffin: KCNA10 Antibody [NBP3-10357] - Immunohistochemical analysis of formalin-fixed paraffin-embedded human heart tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Applications for KCNA10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNA10

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Four sequence-related potassium channel genes, shaker, shaw, shab, and shal, have been identified in Drosophila, and each has been shown to have human homolog(s). KCNA10 encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP.

Long Name

Potassium voltage-gated channel subfamily A member 10

Alternate Names

cyclic GMP gated potassium channel, Kcn1, Kv1.8, potassium voltage-gated channel subfamily A member 10, potassium voltage-gated channel, shaker-related subfamily, member 10, Voltage-gated potassium channel subunit Kv1.8

Gene Symbol

KCNA10

Additional KCNA10 Products

Product Documents for KCNA10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNA10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNA10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNA10 Antibody - BSA Free and earn rewards!

Have you used KCNA10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies