KCNE1 Antibody (5B12) - Azide and BSA Free

Novus Biologicals | Catalog # H00003753-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat, Canine, Guinea Pig, Monkey

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 5B12

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

KCNE1 (NP_000210, 67 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP

Specificity

KCNE1 (5B12)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for KCNE1 Antibody (5B12) - Azide and BSA Free

Western Blot: KCNE1 Antibody (5B12) [H00003753-M01]

Western Blot: KCNE1 Antibody (5B12) [H00003753-M01]

Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - Analysis of KCNE1 over-expressed 293 cell line, cotransfected with KCNE1 Validated Chimera RNAi ( Cat # H00003753-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNE1 monoclonal antibody (M01), clone 5B12 (Cat # H00003753-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: KCNE1 Antibody (5B12) [H00003753-M01]

Western Blot: KCNE1 Antibody (5B12) [H00003753-M01]

Western Blot: KCNE1 Antibody (5B12) [H00003753-M01] - analysis of KCNE1 expression in transfected 293T cell line by KCNE1 monoclonal antibody (M01), clone 5B12. Lane 1: KCNE1 transfected lysate (14.7 KDa). Lane 2: Non-transfected lysate.
ELISA: KCNE1 Antibody (5B12) [H00003753-M01]

ELISA: KCNE1 Antibody (5B12) [H00003753-M01]

ELISA: KCNE1 Antibody (5B12) [H00003753-M01] - Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.

Applications for KCNE1 Antibody (5B12) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: KCNE1

The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.

Alternate Names

Delayed rectifier potassium channel subunit IsK, FLJ18426, FLJ38123, IKs producing slow voltage-gated potassium channel subunit beta Mink, ISK, Isk-related subfamily, member 1, JLNS2FLJ94103, LQT2/5, MGC33114, Minimal potassium channel, MinK, potassium voltage-gated channel, Isk-related family, member 1, voltage gated potassiun channel accessory subunit

Entrez Gene IDs

3753 (Human)

Gene Symbol

KCNE1

OMIM

176261 (Human)

Additional KCNE1 Products

Product Documents for KCNE1 Antibody (5B12) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNE1 Antibody (5B12) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for KCNE1 Antibody (5B12) - Azide and BSA Free

Customer Reviews for KCNE1 Antibody (5B12) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review KCNE1 Antibody (5B12) - Azide and BSA Free and earn rewards!

Have you used KCNE1 Antibody (5B12) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...