KCNJ15 Antibody (1B2) - Azide and BSA Free

Novus Biologicals | Catalog # H00003772-M01

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Knockdown Validated

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1B2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

KCNJ15 (NP_002234, 290 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY

Specificity

KCNJ15 (1B2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for KCNJ15 Antibody (1B2) - Azide and BSA Free

Western Blot: KCNJ15 Antibody (1B2) [H00003772-M01]

Western Blot: KCNJ15 Antibody (1B2) [H00003772-M01]

Western Blot: KCNJ15 Antibody (1B2) [H00003772-M01] - Analysis of KCNJ15 expression in transfected 293T cell line by KCNJ15 monoclonal antibody (M01), clone 1B2.Lane 1: KCNJ15 transfected lysate(42.6 KDa).Lane 2: Non-transfected lysate.
Western Blot: KCNJ15 Antibody (1B2) [H00003772-M01]

Western Blot: KCNJ15 Antibody (1B2) [H00003772-M01]

Western Blot: KCNJ15 Antibody (1B2) [H00003772-M01] - Analysis of KCNJ15 over-expressed 293 cell line, cotransfected with KCNJ15 Validated Chimera RNAi ( Cat # H00003772-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNJ15 monoclonal antibody (M01), clone 1B2 (Cat # H00003772-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: KCNJ15 Antibody (1B2) [H00003772-M01] - Detection limit for recombinant GST tagged KCNJ15 is 3 ng/ml as a capture antibody.

Applications for KCNJ15 Antibody (1B2) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500RNAi Validation
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: KCNJ15

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene.

Alternate Names

inward rectifier K+ channel KIR4.2, inwardly rectifing potassium channel Kir4.210ATP-sensitive inward rectifier potassium channel 15, inwardly rectifying subfamily J member 15, KCNJ14, Kir1.3, KIR4.2, MGC13584, potassium inwardly-rectifying channel, subfamily J, member 15

Entrez Gene IDs

3772 (Human)

Gene Symbol

KCNJ15

OMIM

602106 (Human)

Additional KCNJ15 Products

Product Documents for KCNJ15 Antibody (1B2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNJ15 Antibody (1B2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNJ15 Antibody (1B2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review KCNJ15 Antibody (1B2) - Azide and BSA Free and earn rewards!

Have you used KCNJ15 Antibody (1B2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...