KCNJ15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83091

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Mouse

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KCNJ15 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KCNJ15 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: KCNJ15 Antibody [NBP1-83091]

Immunocytochemistry/ Immunofluorescence: KCNJ15 Antibody [NBP1-83091]

Immunocytochemistry/Immunofluorescence: KCNJ15 Antibody [NBP1-83091] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry: KCNJ15 Antibody [NBP1-83091]

Immunohistochemistry: KCNJ15 Antibody [NBP1-83091]

KCNJ15-Antibody-Immunohistochemistry-NBP1-83091-img0010.jpg
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091]

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091]

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091]

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091]

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human kidney shows strong membranous/cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091]

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091]

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human prostate strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091]

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091]

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human stomach shows strong membranous/cytoplasmic positivity in glandular cells.
KCNJ15 Antibody

Immunohistochemistry: KCNJ15 Antibody [NBP1-83091] -

Protein expression alterations in PanIN and pancreatic adenocarcinomaLeft, Representative immunohistochemistry images of normal pancreatic duct, PanINs and pancreatic cancer tissues for: Gata4, Kcnj15 and Reg4. Scale bar is 50 μm. Right, Number of tumor microarray cores at each labeling score (negative, weak, or strong).

Applications for KCNJ15 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNJ15

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene.

Alternate Names

inward rectifier K+ channel KIR4.2, inwardly rectifing potassium channel Kir4.210ATP-sensitive inward rectifier potassium channel 15, inwardly rectifying subfamily J member 15, KCNJ14, Kir1.3, KIR4.2, MGC13584, potassium inwardly-rectifying channel, subfamily J, member 15

Gene Symbol

KCNJ15

Additional KCNJ15 Products

Product Documents for KCNJ15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KCNJ15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for KCNJ15 Antibody - BSA Free

Customer Reviews for KCNJ15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNJ15 Antibody - BSA Free and earn rewards!

Have you used KCNJ15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies