KCNN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84112

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Monkey

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNN2. Peptide sequence: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KCNN2 Antibody - BSA Free

Western Blot: KCNN2 Antibody [NBP2-84112]

Western Blot: KCNN2 Antibody [NBP2-84112]

Western Blot: KCNN2 Antibody [NBP2-84112] - Host: Rabbit. Target Name: KCNN2. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml
Immunohistochemistry: KCNN2 Antibody [NBP2-84112]

Immunohistochemistry: KCNN2 Antibody [NBP2-84112]

Immunohistochemistry: KCNN2 Antibody [NBP2-84112] - Sample Type: Rhesus macaque spinal cord. Primary Antibody Dilution: 1:300. Secondary Antibody: Donkey anti Rabbit 488. Secondary Antibody Dilution: 1:500. Color/Signal Descriptions: Green: KCNN2. Gene Name: KCNN2. Submitted by: Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706
Western Blot: KCNN2 Antibody [NBP2-84112]

Western Blot: KCNN2 Antibody [NBP2-84112]

Western Blot: KCNN2 Antibody [NBP2-84112] - WB Suggested Anti-KCNN2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Muscle
Western Blot: KCNN2 Antibody [NBP2-84112]

Western Blot: KCNN2 Antibody [NBP2-84112]

Western Blot: KCNN2 Antibody [NBP2-84112] - Host: Rabbit. Target Name: KCNN2. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: KCNN2 Antibody [NBP2-84112]

Western Blot: KCNN2 Antibody [NBP2-84112]

Western Blot: KCNN2 Antibody [NBP2-84112] - Host: Rabbit. Target Name: KCNN2. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: KCNN2 Antibody [NBP2-84112]

Western Blot: KCNN2 Antibody [NBP2-84112]

Western Blot: KCNN2 Antibody [NBP2-84112] - Host: Rabbit. Target: KCNN2. Positive control (+): Human liver (LI). Negative control (-): HeLa (HL). Antibody concentration: 1ug/ml

Applications for KCNN2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNN2

Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This gene is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Long Name

Small conductance calcium-activated potassium channel protein 2

Alternate Names

KCa2.2, SKCa 2, SKCa2

Gene Symbol

KCNN2

Additional KCNN2 Products

Product Documents for KCNN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNN2 Antibody - BSA Free and earn rewards!

Have you used KCNN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...