KHDRBS3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55220

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (93%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KHDRBS3 Antibody - BSA Free

Western Blot: KHDRBS3 Antibody [NBP2-55220]

Western Blot: KHDRBS3 Antibody [NBP2-55220]

Western Blot: KHDRBS3 Antibody [NBP2-55220] - Analysis in human cell line U-2 OS and human cell line A-431.
Immunocytochemistry/ Immunofluorescence: KHDRBS3 Antibody [NBP2-55220]

Immunocytochemistry/ Immunofluorescence: KHDRBS3 Antibody [NBP2-55220]

Immunocytochemistry/Immunofluorescence: KHDRBS3 Antibody [NBP2-55220] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
KHDRBS3 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: KHDRBS3 Antibody - BSA Free [NBP2-55220]

Chromatin Immunoprecipitation-exo-Seq: KHDRBS3 Antibody - BSA Free [NBP2-55220]

ChIP-Exo-Seq composite graph for Anti-KHDRBS3 (NBP2-55220) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for KHDRBS3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KHDRBS3

RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. May play a role as a negative regulator of cell growth. Inhibits cell proliferation. Involved in splice site selection of vascular endothelial growth factor. Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. Involved in post-transcriptional regulation of HIV-1 gene expression.

Alternate Names

Etle, etoile, KH domain containing, RNA binding, signal transduction associated 3, SALPRNA-binding protein T-Star, Sam68-like mammalian protein 2, Sam68-like phosphotyrosine protein, Sam68-like phosphotyrosine protein, T-STAR, SLM-2KH domain-containing, RNA-binding, signal transduction-associated protein 3, SLM2TSTAR, T-STAR

Gene Symbol

KHDRBS3

Additional KHDRBS3 Products

Product Documents for KHDRBS3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KHDRBS3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KHDRBS3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KHDRBS3 Antibody - BSA Free and earn rewards!

Have you used KHDRBS3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...