KHSRP Antibody (4V4O1)

Novus Biologicals | Catalog # NBP3-16746

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4V4O1 expressed in HEK293
View all KHSRP Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human KHSRP (Q92945). MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KHSRP Antibody (4V4O1)

Western Blot: KHSRP Antibody (4V4O1) [NBP3-16746]

Western Blot: KHSRP Antibody (4V4O1) [NBP3-16746]

Western Blot: KHSRP Antibody (4V4O1) [NBP3-16746] - Western blot analysis of extracts of various cell lines, using KHSRP Rabbit mAb (NBP3-16746) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunoprecipitation: KHSRP Antibody (4V4O1) [NBP3-16746]

Immunoprecipitation: KHSRP Antibody (4V4O1) [NBP3-16746]

Immunoprecipitation: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunoprecipitation analysis of 300ug extracts of HepG2 cells using 3ug KHSRP antibody (NBP3-16746). Western blot was performed from the immunoprecipitate using KHSRP antibody (NBP3-16746) at a dilition of 1:1000.
KHSRP Antibody (4V4O1)

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] -

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded rat liver tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KHSRP Antibody (4V4O1)

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] -

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse liver tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KHSRP Antibody (4V4O1)

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] -

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse colon tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KHSRP Antibody (4V4O1)

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] -

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded human thyroid tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KHSRP Antibody (4V4O1)

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] -

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded human breast cancer tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KHSRP Antibody (4V4O1)

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] -

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded rat colon tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KHSRP Antibody (4V4O1)

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] -

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded human esophagus tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KHSRP Antibody (4V4O1)

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] -

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse spleen tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KHSRP Antibody (4V4O1)

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] -

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded human breast tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KHSRP Antibody (4V4O1)

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] -

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse heart tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for KHSRP Antibody (4V4O1)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: KHSRP

KH-type splicing regulatory protein (KSRP) contains four K homology RNA-binding domains. KH domains are found in a wide variety of proteins including ribosomal proteins, transcription factors, and mRNA processing proteins. KSRP has been found to promote the degradation of mRNAs that encode proteins involved in proliferation and the inflammatory response. Alternative names for KSRP include Far upstream element-binding protein 2, FUSE-binding protein 2, p75 and FUBP2.

Alternate Names

FBP2far upstream element-binding protein 2, FUBP2p75, FUSE binding protein 2, FUSE-binding protein 2, KH type-splicing regulatory protein, KH-type splicing regulatory protein, KSRPMGC99676

Gene Symbol

KHSRP

Additional KHSRP Products

Product Documents for KHSRP Antibody (4V4O1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KHSRP Antibody (4V4O1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KHSRP Antibody (4V4O1)

There are currently no reviews for this product. Be the first to review KHSRP Antibody (4V4O1) and earn rewards!

Have you used KHSRP Antibody (4V4O1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies