KIF20A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87689

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIF20A. Peptide sequence: KRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KIF20A Antibody - BSA Free

Western Blot: KIF20A Antibody [NBP2-87689]

Western Blot: KIF20A Antibody [NBP2-87689]

Western Blot: KIF20A Antibody [NBP2-87689] - KIF20A antibody - middle region validated by WB using 721_B Cell Lysate at 1ug/ml. KIF20A is supported by BioGPS gene expression data to be expressed in 721_B
Immunohistochemistry: KIF20A Antibody [NBP2-87689]

Immunohistochemistry: KIF20A Antibody [NBP2-87689]

Immunohistochemistry: KIF20A Antibody [NBP2-87689] - Immunohistochemistry with Human Thyroid lysate tissue at an antibody concentration of 5.0ug/ml using anti-KIF20A antibody
Immunohistochemistry: KIF20A Antibody [NBP2-87689]

Immunohistochemistry: KIF20A Antibody [NBP2-87689]

Immunohistochemistry: KIF20A Antibody [NBP2-87689] - Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue
Immunohistochemistry: KIF20A Antibody [NBP2-87689]

Immunohistochemistry: KIF20A Antibody [NBP2-87689]

Immunohistochemistry: KIF20A Antibody [NBP2-87689] - Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue
Immunohistochemistry: KIF20A Antibody [NBP2-87689]

Immunohistochemistry: KIF20A Antibody [NBP2-87689]

Immunohistochemistry: KIF20A Antibody [NBP2-87689] - Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue

Applications for KIF20A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KIF20A

KIF20A is a member of the kinesin-like protein family and has 1 kinesin motor domain. It interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B and may act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. KIF20A has a microtubule plus end-directed motility.

Alternate Names

FLJ21151, GG10_2, kinesin family member 20A, kinesin-like protein KIF20A, mitotic kinesin-like protein 2, MKLP2, Rab6-interacting kinesin-like protein, RAB6KIFLkinesin-like (rabkinesin6), Rabkinesin-6

Gene Symbol

KIF20A

Additional KIF20A Products

Product Documents for KIF20A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KIF20A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KIF20A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KIF20A Antibody - BSA Free and earn rewards!

Have you used KIF20A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...