KLC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83722

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TLEDCASRNRKQGLDPASQTKVVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KLC2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: KLC2 Antibody [NBP1-83722]

Immunocytochemistry/ Immunofluorescence: KLC2 Antibody [NBP1-83722]

Immunocytochemistry/Immunofluorescence: KLC2 Antibody [NBP1-83722] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722]

Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722]

Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: KLC2 Antibody [NBP1-83722]

Western Blot: KLC2 Antibody [NBP1-83722]

Western Blot: KLC2 Antibody [NBP1-83722] - Analysis using Anti-KLC2 antibody NBP1-83722 (A) shows similar pattern to independent antibody NBP1-83723 (B).
Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722]

Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722]

Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722]

Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722]

Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722] - Staining of human cerebral cortex, fallopian tube, prostate and testis using Anti-KLC2 antibody NBP1-83722 (A) shows similar protein distribution across tissues to independent antibody NBP1-83723 (B).
Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722]

Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722]

Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722] - Staining of human Fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722]

Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722]

Immunohistochemistry-Paraffin: KLC2 Antibody [NBP1-83722] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
KLC2 Antibody - BSA Free Western Blot: KLC2 Antibody - BSA Free [NBP1-83722]

Western Blot: KLC2 Antibody - BSA Free [NBP1-83722]

Analysis in U-138MG cells) transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-KLC2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Applications for KLC2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:10-1:20

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KLC2

Kinesin is a molecular motor that generates ATP-dependent movement of vesicles and organelles along microtubules. Kinesin consists of 2 light chains, such as KLC2, and 2 heavy chains (see KIF5B; MIM 602809) in a 1:1 stoichiometric ratio (Rahman et al., 1998 [PubMed 9624122]).[supplied by OMIM]

Alternate Names

FLJ12387, kinesin light chain 2, KLC 2

Gene Symbol

KLC2

Additional KLC2 Products

Product Documents for KLC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KLC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KLC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KLC2 Antibody - BSA Free and earn rewards!

Have you used KLC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...