Kv12.2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14142

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Kv12.2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Kv12.2 Antibody [NBP2-14142]

Immunocytochemistry/ Immunofluorescence: Kv12.2 Antibody [NBP2-14142]

Immunocytochemistry/Immunofluorescence: Kv12.2 Antibody [NBP2-14142] - Staining of human cell line A549 shows localization to nucleus & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Kv12.2 Antibody [NBP2-14142]

Immunohistochemistry-Paraffin: Kv12.2 Antibody [NBP2-14142]

Immunohistochemistry-Paraffin: Kv12.2 Antibody [NBP2-14142] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Applications for Kv12.2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kv12.2

Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits an outward current with fast inactivation. Channel properties may be modulated by cAMP and subunit assembly

Alternate Names

BEC1, brain-specific eag-like channel 1, ELK channel 2, ELK2, ether-a-go-go K(+) channel family member, ether-a-go-go-like potassium channel 2, KIAA1282, Kv12.2, potassium voltage-gated channel subfamily H member 3, potassium voltage-gated channel, subfamily H (eag-related), member 3, voltage-gated potassium channel subunit Kv12.2

Gene Symbol

KCNH3

Additional Kv12.2 Products

Product Documents for Kv12.2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kv12.2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kv12.2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kv12.2 Antibody - BSA Free and earn rewards!

Have you used Kv12.2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kv12.2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I am interested in your Kv12.2 antibody, but I see on your website that the only image is IHC of human kidney (and this was using NBP2-14142). I was wondering whether you have any images using brain tissue/brain lysate, as well as any images using NBP1-30641, as I am also interesting in running westerns with the antibody. Additionally, do you have a control peptide and Kv12.2 over-expressing lysate for the antibody?

    A: NBP1-14142 has only been validated in IHC on paraffin-embedded tissues and has not been tested for its use in Western blot. NBP1-30641 has been validated in Western blot and IHC on both frozen and paraffin-embedded tissues. We do not currently have any images for this but this product is 100% guaranteed for the applications and species listed on the datasheet. We do not currently have a positive control lysate for this target.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...