Kv3.3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10356

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Kv3.3 (NP_004968). Peptide sequence YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Kv3.3 Antibody - BSA Free

Western Blot: Kv3.3 Antibody [NBP3-10356]

Western Blot: Kv3.3 Antibody [NBP3-10356]

Western Blot: Kv3.3 Antibody [NBP3-10356] - Western blot analysis of Kv3.3 in Human liver. Antibody dilution at 1 ug/mL

Applications for Kv3.3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kv3.3

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Alternate Names

KSHIIID, Kv3.3, potassium voltage-gated channel subfamily C member 3, potassium voltage-gated channel, Shaw-related subfamily, member 3, SCA13, Shaw-related voltage-gated potassium channel protein 3, spinocerebellar ataxia 13, voltage-gated potassium channel protein KV3.3, Voltage-gated potassium channel subunit Kv3.3

Gene Symbol

KCNC3

Additional Kv3.3 Products

Product Documents for Kv3.3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kv3.3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kv3.3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kv3.3 Antibody - BSA Free and earn rewards!

Have you used Kv3.3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...