Lactate Dehydrogenase B Antibody (6B5I2)

Novus Biologicals | Catalog # NBP3-16569

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6B5I2 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lactate Dehydrogenase B (P07195). MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lactate Dehydrogenase B Antibody (6B5I2)

Western Blot: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Western Blot: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Western Blot: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569] - Western blot analysis of extracts of various cell lines, using Lactate Dehydrogenase B Rabbit mAb (NBP3-16569) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569] - Immunohistochemistry of paraffin-embedded human appendix using Lactate Dehydrogenase B Rabbit mAb (NBP3-16569) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569] - Immunohistochemistry of paraffin-embedded rat ovary using Lactate Dehydrogenase B Rabbit mAb (NBP3-16569) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunoprecipitation: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Immunoprecipitation: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569]

Immunoprecipitation: Lactate Dehydrogenase B Antibody (6B5I2) [NBP3-16569] - Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug Lactate Dehydrogenase B antibody (NBP3-16569). Western blot was performed from the immunoprecipitate using Lactate Dehydrogenase B antibody (NBP3-16569) at a dilition of 1:1000.

Applications for Lactate Dehydrogenase B Antibody (6B5I2)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:10-1:500

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lactate Dehydrogenase B/LDHB

Lactate dehydrogenase (LDH) is an ubiquitous enzyme commonly found in wide variety of organisms, including plants and microbes. LDH is involved in the interconversion of the pyruvate and NADH to lactate and NAD+. It is also called Hydroxybutyrate Dehydrogenase (HBD), because it can catalyze the oxidation of hydroxybutyrate (1). In mammals, three types of LDH subunits (35 kDa) are encoded by the genes Ldh-A, Ldh-B, and Ldh-C. All LDH subunits can combine to form various terameric isoenzymes (140 kDa). Lactate dehydrogenase B (LDH-B, heart subunit, LDH-H) is involved in the conversion of L-lactate and NAD to pryruvate and NADH and it is predominantly localized in the heart tissue. Similar to other LDH subunit, LDH-B is considered to be an important marker for germ cell tumor (2).

Alternate Names

Epididymis Secretory Protein Li 281, HEL-S-281, LDH-H, LDHB, LDHBD, Renal Carcinoma Antigen NY-REN-46, TRG-5

Gene Symbol

LDHB

Additional Lactate Dehydrogenase B/LDHB Products

Product Documents for Lactate Dehydrogenase B Antibody (6B5I2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lactate Dehydrogenase B Antibody (6B5I2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lactate Dehydrogenase B Antibody (6B5I2)

There are currently no reviews for this product. Be the first to review Lactate Dehydrogenase B Antibody (6B5I2) and earn rewards!

Have you used Lactate Dehydrogenase B Antibody (6B5I2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...