Lactate Dehydrogenase B Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-55415
![Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]](https://resources.rndsystems.com/images/products/Lactate-Dehydrogenase-B-Antibody-Western-Blot-NBP1-55415-img0011.jpg "Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human Lactate Dehydrogenase B. Peptide Sequence MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for Lactate Dehydrogenase B Antibody - BSA Free
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12![Immunohistochemistry: Lactate Dehydrogenase B Antibody [NBP1-55415]](https://resources.rndsystems.com/images/products/Lactate-Dehydrogenase-B-Antibody-Immunohistochemistry-NBP1-55415-img0006.jpg "Immunohistochemistry: Lactate Dehydrogenase B Antibody [NBP1-55415]")
Immunohistochemistry: Lactate Dehydrogenase B Antibody [NBP1-55415]
Immunohistochemistry: Lactate Dehydrogenase B Antibody [NBP1-55415] - Human Placenta Antibody Concentration: 5 ug/ml.![Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]](https://resources.rndsystems.com/images/products/Lactate-Dehydrogenase-B-Antibody-Western-Blot-NBP1-55415-img0001.jpg "Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]")
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Human pancreatic cancer cell line MiaPaca-2 and Panc-1, concentration 1 ug/ml.![Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]](https://resources.rndsystems.com/images/products/Lactate-Dehydrogenase-B-Antibody-Western-Blot-NBP1-55415-img0002.jpg "Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]")
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - 721_B Whole Cell, concentration 1 ug/ml.![Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]](https://resources.rndsystems.com/images/products/Lactate-Dehydrogenase-B-Antibody-Western-Blot-NBP1-55415-img0007.jpg "Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]")
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Antibody Titration: 1 ug/ml Human 721_B.![Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]](https://resources.rndsystems.com/images/products/Lactate-Dehydrogenase-B-Antibody-Western-Blot-NBP1-55415-img0008.jpg "Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]")
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Antibody Titration: 1 ug/ml Human Raji.![Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]](https://resources.rndsystems.com/images/products/Lactate-Dehydrogenase-B-Antibody-Western-Blot-NBP1-55415-img0010.jpg "Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]")
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Lanes: 1. 30 ug MiaPaca-2 cell lysate 2. 30 ug Panc-1 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Goat anti-Rabbit HRP Secondary, Antibody Dilution: 1 : 4000 Gene name: LDHB.![Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]](https://resources.rndsystems.com/images/products/Lactate-Dehydrogenase-B-Antibody-Western-Blot-NBP1-55415-img0009.jpg "Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]")
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415]
Western Blot: Lactate Dehydrogenase B Antibody [NBP1-55415] - Lane A: Human Fetal Lung Lane B: Human HCT116 Lane C: Human 293T, Antibody Dilution: 0.2 ug/ml.Applications for Lactate Dehydrogenase B Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Lactate Dehydrogenase B/LDHB
Alternate Names
Epididymis Secretory Protein Li 281, HEL-S-281, LDH-H, LDHB, LDHBD, Renal Carcinoma Antigen NY-REN-46, TRG-5
Gene Symbol
LDHB
UniProt
Additional Lactate Dehydrogenase B/LDHB Products
Product Documents for Lactate Dehydrogenase B Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Lactate Dehydrogenase B Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Lactate Dehydrogenase B Antibody - BSA Free
Powered by Bioz
Customer Reviews for Lactate Dehydrogenase B Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Lactate Dehydrogenase B Antibody - BSA Free and earn rewards!
Have you used Lactate Dehydrogenase B Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...