LACTB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91701

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LACTB Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFENSIESLRLFKNDPLFFKPGSQFLYSTFGYTLL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LACTB Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LACTB Antibody [NBP1-91701]

Immunocytochemistry/ Immunofluorescence: LACTB Antibody [NBP1-91701]

Immunocytochemistry/Immunofluorescence: LACTB Antibody [NBP1-91701] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701]

Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701]

Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701]

Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701]

Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701]

Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701]

Immunohistochemistry-Paraffin: LACTB Antibody [NBP1-91701] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
LACTB Antibody - BSA Free Immunohistochemistry: LACTB Antibody - BSA Free [NBP1-91701]

Immunohistochemistry: LACTB Antibody - BSA Free [NBP1-91701]

Staining of human lymph node shows strong granular cytoplasmic positivity in germinal center cells.
LACTB Antibody - BSA Free Western Blot: LACTB Antibody - BSA Free [NBP1-91701]

Western Blot: LACTB Antibody - BSA Free [NBP1-91701]

Analysis in human cell line RT-4.

Applications for LACTB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LACTB

This gene encodes a mitochondrially-localized protein that has sequence similarity to prokaryotic beta-lactamases. Many of the residues responsible for beta-lactamase activity are not conserved in this protein, suggesting it may have a different enzymatic function. Increased expression of the related mouse gene was found to be associated with obesity. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Dec 2013]

Alternate Names

AmpC, EC 3.4, FLJ14902, G24, lactamase, beta, mitochondrial 39S ribosomal protein L56, mitochondrial ribosomal protein L56, MRPL56, serine beta lactamase-like protein LACTB, serine beta-lactamase-like protein LACTB, mitochondrial

Gene Symbol

LACTB

Additional LACTB Products

Product Documents for LACTB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LACTB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LACTB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LACTB Antibody - BSA Free and earn rewards!

Have you used LACTB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies