LAMC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-05167

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 746-860 of human LAMC2 (NP_005553.2). DHYVGPNGFKSLAQEATRLAESHVESASNMEQLTRETEDYSKQALSLVRKALHEGVGSGSGSPDGAVVQGLVEKLEKTKSLAQQLTREATQAEIEADRSYQHSLRLLDSVSRLQG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

131 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for LAMC2 Antibody - BSA Free

LAMC2 Antibody - Azide and BSA Free

Western Blot: LAMC2 Antibody - Azide and BSA Free [LAMC2] -

Western Blot: LAMC2 Antibody - Azide and BSA Free [LAMC2] - Western blot analysis of various lysates, using LAMC2 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
LAMC2 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: LAMC2 Antibody - Azide and BSA Free [LAMC2] -

LAMC2 Antibody - Azide and BSA Free [LAMC2] - Analysis of paraffin-embedded mouse kidney using LAMC2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
LAMC2 Antibody - Azide and BSA Free

LAMC2 Antibody -

LAMC2 Antibody - Azide and BSA Free [LAMC2] - Analysis of paraffin-embedded rat kidney using LAMC2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
LAMC2 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: LAMC2 Antibody - Azide and BSA Free [LAMC2] -

Immunocytochemistry/ Immunofluorescence: LAMC2 Antibody - Azide and BSA Free [LAMC2] - Immunofluorescence analysis of A-431 cells using LAMC2 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for LAMC2 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: LAMC2

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the gamma chain isoform laminin, gamma 2. The gamma 2 chain, formerly thought to be a truncated version of beta chain (B2t), is highly homologous to the gamma 1 chain; however, it lacks domain VI, and domains V, IV and III are shorter. It is expressed in several fetal tissues but differently from gamma 1, and is specifically localized to epithelial cells in skin, lung and kidney. The gamma 2 chain together with alpha 3 and beta 3 chains constitute laminin 5 (earlier known as kalinin), which is an integral part of the anchoring filaments that connect epithelial cells to the underlying basement membrane. The epithelium-specific expression of the gamma 2 chain implied its role as an epithelium attachment molecule, and mutations in this gene have been associated with junctional epidermolysis bullosa, a skin disease characterized by blisters due to disruption of the epidermal-dermal junction. Two transcript variants resulting from alternative splicing of the 3' terminal exon, and encoding different isoforms of gamma 2 chain, have been described. The two variants are differentially expressed in embryonic tissues, however, the biological significance of the two forms is not known. Transcript variants utilizing alternative polyA_signal have also been noted in literature.

Alternate Names

BM600, BM600-100kDa, Cell-scattering factor 140 kDa subunit, CSF, CSF 140 kDa subunit, EBR2, EBR2A, Epiligrin subunit gamma, kalinin (105kD), Kalinin subunit gamma, Kalinin/nicein/epiligrin 100 kDa subunit, kalinin-105kDa, ladsin (140kDa), Ladsin 140 kDa subunit, LAMB2Tlaminin, gamma 2 (nicein (100kD), kalinin (105kD), BM600 (100kD), Herlitzjunctional epidermolysis bullosa)), Laminin B2t chain, laminin subunit gamma-2, laminin, gamma 2, Laminin-5 subunit gamma, LAMNB2B2T, Large adhesive scatter factor 140 kDa subunit, MGC138491, MGC141938, nicein (100kDa), Nicein subunit gamma, nicein-100kDa

Gene Symbol

LAMC2

Additional LAMC2 Products

Product Documents for LAMC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LAMC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LAMC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LAMC2 Antibody - BSA Free and earn rewards!

Have you used LAMC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...