Lamin B Receptor Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14185

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Lamin B Receptor Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFRQRKGGSTSSS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%) Use in Mouse reported in scientific literature (PMID:33846535).

Marker

Nuclear Inner Membrane Marke

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lamin B Receptor Antibody - BSA Free

Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185]

Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185]

Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185] - Analysis in human lymph node and skeletal muscle tissues. Corresponding LBR RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185]

Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185]

Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185] - Staining of human testis shows strong positivity in nuclear membrane in subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185]

Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185]

Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185]

Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185]

Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185] - Staining of human lymph node shows moderate to strong positivity in nuclear membrane.
Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185]

Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185]

Immunohistochemistry-Paraffin: Lamin B Receptor Antibody [NBP2-14185] - Staining of human small intestine shows strong positivity in nuclear membrane in glandular cells.

Applications for Lamin B Receptor Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lamin B Receptor

Lamins are nuclear membrane proteins that serve to maintain specific cellular functions, such as DNA replication and chromatin organization (1). Lamin B receptor (LBR) is an integral protein of the nuclear envelope inner membrane. It is phosphorylated by CDC2 protein kinase in mitosis when the inner nuclear membrane breaks down into vesicles that dissociate from the lamina and the chromatin. It is phosphorylated by different protein kinases in interphase when the membrane is associated with these structures (2). The cleavage of lamins results in nuclear disregulation and cell death (3,4).

Alternate Names

DHCR14B, FLJ43126, Integral nuclear envelope inner membrane protein, lamin B receptor, lamin-B receptor, LMN2R, MGC9041, PHA

Gene Symbol

LBR

Additional Lamin B Receptor Products

Product Documents for Lamin B Receptor Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Lamin B Receptor Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Lamin B Receptor Antibody - BSA Free

Customer Reviews for Lamin B Receptor Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lamin B Receptor Antibody - BSA Free and earn rewards!

Have you used Lamin B Receptor Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies