Leptin R Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP1-85765PEP

Novus Biologicals
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
View all Leptin R Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LEPR.

Source: E. coli

Amino Acid Sequence: IYFPPKILTSVGSNVSFHCIYKKENKIVPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHHRYAEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85765.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP1-85765PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Leptin R

Leptin receptor (OB-R) is a type I cytokine receptor family protein with significant amino acid sequence identity with gp130, G-CSF receptor, and LIF receptor. An OB-R transcript encodes a soluble form of the receptor. The transcript was reported to be expressed predominantly in regions of the hypothalamus previously thought to be important in body weight regulation. OB-R binds leptin with high affinity and is a potent leptin antagonist. Human OB-R encodes a 1 165 amino acid residue precursor protein with a 22 amino acid residue signal peptide, an 816 amino acid residue extracellular domain, a 21 amino acid residue transmembrane domain and a 303 amino acid residue cytoplasmic domain.

Long Name

Leptin Receptor

Alternate Names

B219, CD295, LEPR, LeptinR, OB R

Gene Symbol

LEPR

Additional Leptin R Products

Product Documents for Leptin R Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Leptin R Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Leptin R Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review Leptin R Recombinant Protein Antigen and earn rewards!

Have you used Leptin R Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes