Leukotriene B4 Receptor 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09429

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Leukotriene B4 R2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Leukotriene B4 Receptor 2. Peptide sequence TRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Leukotriene B4 Receptor 2 Antibody - BSA Free

Western Blot: Leukotriene B4 Receptor 2 Antibody [NBP3-09429]

Western Blot: Leukotriene B4 Receptor 2 Antibody [NBP3-09429]

Western Blot: Leukotriene B4 Receptor 2 Antibody [NBP3-09429] - Western blot analysis of Leukotriene B4 Receptor 2 in Placenta lysates. Antibody dilution at 1.0ug/ml

Applications for Leukotriene B4 Receptor 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Leukotriene B4 R2

LUSTR2 is an Orphan-U GPCR with an unknown ligand. ESTs have been isolated from human tissue libraries, especially normal kidney, ovary and pituitary, and cancerous bladder, duodenum, genitourinary tract and placenta.

Long Name

Leukotriene B4 Receptor 2

Alternate Names

BLT2, BLTR2, JULF2, Leukotriene B4R2, LTB4R2, NOP9

Gene Symbol

LTB4R2

Additional Leukotriene B4 R2 Products

Product Documents for Leukotriene B4 Receptor 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Leukotriene B4 Receptor 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Leukotriene B4 Receptor 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Leukotriene B4 Receptor 2 Antibody - BSA Free and earn rewards!

Have you used Leukotriene B4 Receptor 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies