Leupaxin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-31078

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Leupaxin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSML

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Leupaxin Antibody - BSA Free

Western Blot: Leupaxin Antibody [NBP2-31078]

Western Blot: Leupaxin Antibody [NBP2-31078]

Western Blot: Leupaxin Antibody [NBP2-31078] - Analysis using Anti-LPXN antibody NBP2-31078 (A) shows similar pattern to independent antibody NBP2-55850 (B).
Immunohistochemistry-Paraffin: Leupaxin Antibody [NBP2-31078]

Immunohistochemistry-Paraffin: Leupaxin Antibody [NBP2-31078]

Immunohistochemistry-Paraffin: Leupaxin Antibody [NBP2-31078] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells, germinal center cells were moderately stained.
Western Blot: Leupaxin Antibody [NBP2-31078]

Western Blot: Leupaxin Antibody [NBP2-31078]

Western Blot: Leupaxin Antibody [NBP2-31078] - Analysis in human cell lines PC-3 and Caco-2 using anti-LPXN antibody. Corresponding LPXN RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.

Applications for Leupaxin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Leupaxin

The product encoded by this gene is preferentially expressed in hematopoietic cells and is most homologous to the focal adhesion protein, paxillin. It may function in cell type-specific signaling by associating with PYK2, a member of focal adhesion kinase family. As a substrate for a tyrosine kinase in lymphoid cells, this protein may also function in, and be regulated by tyrosine kinase activity. [provided by RefSeq]

Alternate Names

LDLP, LDPL, leupaxin

Gene Symbol

LPXN

Additional Leupaxin Products

Product Documents for Leupaxin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Leupaxin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Leupaxin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Leupaxin Antibody - BSA Free and earn rewards!

Have you used Leupaxin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies