Lgl1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15981

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Lgl1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human Lgl1 (NP_004131.3). MMKFRFRRQGADPQREKLKQELFAFNKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVTVVLLVAAGDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lgl1 Antibody - Azide and BSA Free

Western Blot: Lgl1 AntibodyAzide and BSA Free [NBP3-15981]

Western Blot: Lgl1 AntibodyAzide and BSA Free [NBP3-15981]

Western Blot: Lgl1 Antibody [NBP3-15981] - Analysis of extracts of various cell lines, using Lgl1 antibody (NBP3-15981) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Lgl1 AntibodyAzide and BSA Free [NBP3-15981]

Western Blot: Lgl1 AntibodyAzide and BSA Free [NBP3-15981]

Western Blot: Lgl1 Antibody [NBP3-15981] - Analysis of extracts of Rat testis, using Lgl1 antibody (NBP3-15981) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunohistochemistry-Paraffin: Lgl1 Antibody - Azide and BSA Free [NBP3-15981]

Immunohistochemistry-Paraffin: Lgl1 Antibody - Azide and BSA Free [NBP3-15981]

Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP3-15981] - Human breast cancer using Lgl1 antibody (NBP3-15981) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Lgl1 Antibody - Azide and BSA Free [NBP3-15981]

Immunohistochemistry-Paraffin: Lgl1 Antibody - Azide and BSA Free [NBP3-15981]

Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP3-15981] - Human liver cancer using Lgl1 antibody (NBP3-15981) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Lgl1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Lgl1 Antibody - Azide and BSA Free [Lgl1] -

Immunocytochemistry/ Immunofluorescence: Lgl1 Antibody - Azide and BSA Free [Lgl1] - Immunofluorescence analysis of A-549 cells using Lgl1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Lgl1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Lgl1 Antibody - Azide and BSA Free [Lgl1] -

Immunocytochemistry/ Immunofluorescence: Lgl1 Antibody - Azide and BSA Free [Lgl1] - Immunofluorescence analysis of C6 cells using Lgl1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Lgl1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lgl1

Lgl1 encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine residues. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Alternate Names

DLG4lethal giant larvae (Drosophila) homolog 1, HUGL, HUGL1, HUGL-1, Human homolog to the D-lgl gene protein, lethal giant larvae homolog 1 (Drosophila), lethal(2) giant larvae protein homolog 1, LLGL

Gene Symbol

LLGL1

Additional Lgl1 Products

Product Documents for Lgl1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Lgl1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Lgl1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Lgl1 Antibody - Azide and BSA Free and earn rewards!

Have you used Lgl1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies