LIAS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82845

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LIAS Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LIAS Antibody [NBP1-82845]

Immunocytochemistry/ Immunofluorescence: LIAS Antibody [NBP1-82845]

Immunocytochemistry/Immunofluorescence: LIAS Antibody [NBP1-82845] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry: LIAS Antibody [NBP1-82845]

Immunohistochemistry: LIAS Antibody [NBP1-82845]

Immunohistochemistry: LIAS Antibody [NBP1-82845] - Staining of mouse lateral ventricle shows positivity in a subset of cells in choroid plexus and lateral ventricle wall.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845]

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845]

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.
Immunohistochemistry: LIAS Antibody [NBP1-82845]

Immunohistochemistry: LIAS Antibody [NBP1-82845]

Immunohistochemistry: LIAS Antibody [NBP1-82845] - Staining of mouse subfornical organ shows nuclear positivity in a subset of cells.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845]

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845]

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human hippocampus shows weak cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845]

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845]

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845]

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845]

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845]

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845]

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry: LIAS Antibody [NBP1-82845]

Immunohistochemistry: LIAS Antibody [NBP1-82845]

Immunohistochemistry: LIAS Antibody [NBP1-82845] - Staining of mouse cerebellum shows moderate cytoplasmic positivity in neurons.

Applications for LIAS Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LIAS

LIAS is encoded by this gene belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Alternate Names

EC 2.8.1.8, LASmitochondrial, LIP1, lipoic acid synthetase, Lip-syn, MGC23245

Gene Symbol

LIAS

Additional LIAS Products

Product Documents for LIAS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LIAS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LIAS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LIAS Antibody - BSA Free and earn rewards!

Have you used LIAS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...