LIN7C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85211

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all LIN7C Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LIN7C. Peptide sequence: MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for LIN7C Antibody - BSA Free

Western Blot: LIN7C Antibody [NBP2-85211]

Western Blot: LIN7C Antibody [NBP2-85211]

Western Blot: LIN7C Antibody [NBP2-85211] - WB Suggested Anti-LIN7C Antibody Titration: 1 ug/ml. Positive Control: MCF-7 whole cell lysatesLIN7C is supported by BioGPS gene expression data to be expressed in MCF7

Applications for LIN7C Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LIN7C

LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the corr

Alternate Names

FLJ11215, lin-7 homolog C (C. elegans), LIN-7C, LIN-7-C, MALS-3LIN-7 protein 3, MALS3protein lin-7 homolog C, Mammalian lin-seven protein 3, veli-3, VELI3Lin7c, Vertebrate lin-7 homolog 3

Gene Symbol

LIN7C

Additional LIN7C Products

Product Documents for LIN7C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LIN7C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LIN7C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LIN7C Antibody - BSA Free and earn rewards!

Have you used LIN7C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies