Lipoprotein Lipase/LPL Antibody (10E10P9)
Novus Biologicals | Catalog # NBP3-16334
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, ELISA
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 10E10P9 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 376-475 of human Lipoprotein Lipase/LPL (P06858). IPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Lipoprotein Lipase/LPL Antibody (10E10P9)
Western Blot: Lipoprotein Lipase/LPL Antibody (10E10P9) [NBP3-16334]
Western Blot: Lipoprotein Lipase/LPL Antibody (10E10P9) [NBP3-16334] - Western blot analysis of extracts of Human plasma, using Lipoprotein Lipase/LPL (LPL) Rabbit mAb (NBP3-16334) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.Western Blot: Lipoprotein Lipase/LPL Antibody (10E10P9) [NBP3-16334]
Western Blot: Lipoprotein Lipase/LPL Antibody (10E10P9) [NBP3-16334] - Western blot analysis of extracts of Mouse liver, using Lipoprotein Lipase/LPL (LPL) Rabbit mAb (NBP3-16334) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.Applications for Lipoprotein Lipase/LPL Antibody (10E10P9)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL
Western Blot
1:1000 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Lipoprotein Lipase/LPL
Alternate Names
LIPD, LPL
Gene Symbol
LPL
Additional Lipoprotein Lipase/LPL Products
Product Documents for Lipoprotein Lipase/LPL Antibody (10E10P9)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Lipoprotein Lipase/LPL Antibody (10E10P9)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Lipoprotein Lipase/LPL Antibody (10E10P9)
There are currently no reviews for this product. Be the first to review Lipoprotein Lipase/LPL Antibody (10E10P9) and earn rewards!
Have you used Lipoprotein Lipase/LPL Antibody (10E10P9)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...