Lipoprotein Lipase/LPL Antibody (10E10P9)

Novus Biologicals | Catalog # NBP3-16334

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10E10P9 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 376-475 of human Lipoprotein Lipase/LPL (P06858). IPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Lipoprotein Lipase/LPL Antibody (10E10P9)

Western Blot: Lipoprotein Lipase/LPL Antibody (10E10P9) [NBP3-16334]

Western Blot: Lipoprotein Lipase/LPL Antibody (10E10P9) [NBP3-16334]

Western Blot: Lipoprotein Lipase/LPL Antibody (10E10P9) [NBP3-16334] - Western blot analysis of extracts of Human plasma, using Lipoprotein Lipase/LPL (LPL) Rabbit mAb (NBP3-16334) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Western Blot: Lipoprotein Lipase/LPL Antibody (10E10P9) [NBP3-16334]

Western Blot: Lipoprotein Lipase/LPL Antibody (10E10P9) [NBP3-16334]

Western Blot: Lipoprotein Lipase/LPL Antibody (10E10P9) [NBP3-16334] - Western blot analysis of extracts of Mouse liver, using Lipoprotein Lipase/LPL (LPL) Rabbit mAb (NBP3-16334) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for Lipoprotein Lipase/LPL Antibody (10E10P9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lipoprotein Lipase/LPL

LPL, also known as Lipoprotein lipase, is a 475 amino acid that is 53 kDa, is a vascular lipase, but not synthesized in endothelial cells. It is anchored to the capillary endothelium by proteoglycans and acts as a catalyzer of triglycerides hydrolysis to release free fatty acids into the circulation and initiates the processing of triglyceride-rich lipoproteins such as chylomicrons and VLDL. It is being studied for its involvement in 150+ diseases and disorders including high density lipoprotein cholesterol level qtl 11, hyperlipoproteinemia, lipoprotein lipase deficiency, familial lipoprotein lipase deficiency, hyperlipoproteinemia type v, lipase deficiency combined, hyperlipoproteinemia type iii, glycogen storage disease, hyperlipidemia, hypertriglyceridemia, glucose intolerance, cetp deficiency, hypertension, fatty liver, nephrotic syndrome, kidney failure, and myocardial infarction. This protein has been shown to interact with 50 proteins including COPS6, PTPN4, RPL18A, ASCC2, KIAA1377 in developmental biology, transcriptional regulation of white adipocyte differentiation, lipid digestion, mobilization, and transport, metabolism, lipoprotein metabolism, glycerolipid metabolism, PPAR signaling pathway, and Alzheimer's disease pathways.

Alternate Names

LIPD, LPL

Gene Symbol

LPL

Additional Lipoprotein Lipase/LPL Products

Product Documents for Lipoprotein Lipase/LPL Antibody (10E10P9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lipoprotein Lipase/LPL Antibody (10E10P9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lipoprotein Lipase/LPL Antibody (10E10P9)

There are currently no reviews for this product. Be the first to review Lipoprotein Lipase/LPL Antibody (10E10P9) and earn rewards!

Have you used Lipoprotein Lipase/LPL Antibody (10E10P9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies